EVI-1 Antibody

Images

 
Western Blot: EVI-1 Antibody [H00004197-B01P] - Analysis of MDS1 expression in transfected 293T cell line by MDS1 polyclonal antibody. Lane 1: MDS1 transfected lysate(18.59 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

EVI-1 Antibody Summary

Immunogen
MDS1 (NP_004982.1, 1 a.a. - 169 a.a.) full-length human protein. MRSKGRARKLATNNECVYGNYPEIPLEEMPDADGVASTPSLNIQEPCSPATSSEAFTPKEGSPYKAPIYIPDDIPIPAEFELRESNMPGAGLGIWTKRKIEVGEKFGPYVGEQRSNLKDPSYGWEVHLPRSRRVSVHSWLYLGKRSSDVGIAFSQADVYMPGLQCAFLS
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
MECOM
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EVI-1 Antibody

  • AML1-EVI-1 fusion protein
  • AML1-EVI-1
  • ecotropic viral integration site 1
  • Ecotropic virus integration site 1 protein homolog
  • EVI1
  • EVI-1
  • EVI1MDS1-EVI1
  • MDS1 and EVI1 complex locus protein EVI1
  • MDS1 and EVI1 complex locus protein MDS1
  • MDS1 and EVI1 complex locus
  • MDS1
  • MECOM
  • MGC163392
  • MGC97004
  • Myelodysplasia syndrome 1 protein
  • myelodysplasia syndrome 1
  • Myelodysplasia syndrome-associated protein 1
  • oncogene EVI1
  • PRDM3
  • zinc finger protein Evi1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6295
Species: Hu, Mu
Applications: WB, IHC
NBP1-92025
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00027130-P02
Species: Hu
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
AF5414
Species: Hu
Applications: WB, Simple Western
NBP1-80695
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-06069
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
H00171023-M05
Species: Hu
Applications: WB, ELISA
MAB17791
Species: Hu, Mu
Applications: WB
NBP1-87769
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89827
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
NB100-55256
Species: Hu
Applications: WB, IHC-P, IP
NBP1-89644
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88707
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01294
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-02023
Species: Hu
Applications: WB, ICC/IF
H00004197-B01P
Species: Hu
Applications: WB

Publications for EVI-1 Antibody (H00004197-B01P) (0)

There are no publications for EVI-1 Antibody (H00004197-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EVI-1 Antibody (H00004197-B01P) (0)

There are no reviews for EVI-1 Antibody (H00004197-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EVI-1 Antibody (H00004197-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EVI-1 Products

Bioinformatics Tool for EVI-1 Antibody (H00004197-B01P)

Discover related pathways, diseases and genes to EVI-1 Antibody (H00004197-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EVI-1 Antibody (H00004197-B01P)

Discover more about diseases related to EVI-1 Antibody (H00004197-B01P).
 

Pathways for EVI-1 Antibody (H00004197-B01P)

View related products by pathway.

PTMs for EVI-1 Antibody (H00004197-B01P)

Learn more about PTMs related to EVI-1 Antibody (H00004197-B01P).

Blogs on EVI-1

There are no specific blogs for EVI-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EVI-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MECOM
Entrez
Uniprot