EVER2 Antibody - BSA Free

Immunohistochemistry: EVER2 Antibody [NBP2-49129] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

EVER2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit EVER2 Antibody - BSA Free (NBP2-49129) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VQLENYPPNTEVNLTLIWCVVLKLASLGMFSVSLGQTILCIGRDKSSCESYGYNVCDYQCWENSVGEELYKLS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TMC8
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  EVER2 Recombinant Protein Antigen (NBP2-49129PEP)

Reactivity Notes

Mouse (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for EVER2 Antibody - BSA Free

• epidermodysplasia verruciformis 2
• Epidermodysplasia verruciformis protein 2
• EV2
• EVER2MGC102701
• EVIN2FLJ43684
• FLJ40668
• MGC40121
• transmembrane channel-like 8
• transmembrane channel-like protein 8

Background

SUBCELLULAR LOCATION: Endoplasmic reticulum membrane; Multi-pass membrane protein.; TISSUE SPECIFICITY: Expressed in placenta, prostate and testis. DISEASE: Defects in TMC8 are a cause of epidermodysplasia verruciformis. It is a rare autosomal recessive genodermatosis associated with a high risk of skin carcinoma that results from an abnormal susceptibility to infection by specific human papillomaviruses. Infection leads to persistent wart-like or macular lesions.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TMC8