ETV5/ERM Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: AAGPVQGVGPAPAPHSLPEPGPQQQTFAVPRPPHQPLQMPKMMPENQYPSEQRFQRQ |
| Predicted Species |
Mouse (93%), Rat (93%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ETV5 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:1000 - 1:2500
- Immunohistochemistry-Paraffin 1:1000 - 1:2500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for ETV5/ERM Antibody - BSA Free
Background
ERM / Etv5 binds to DNA sequences containing the consensus nucleotide core sequence GGAA
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC-WhMt, IHC, IHC-P, WB
Species: Hu
Applications: Bind, BA
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Ch, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu, Mu
Applications: BA
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu
Applications: WB
Species: Hu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: Flow, IHC, IHC-P, WB
Publications for ETV5/ERM Antibody (NBP3-17656) (0)
There are no publications for ETV5/ERM Antibody (NBP3-17656).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ETV5/ERM Antibody (NBP3-17656) (0)
There are no reviews for ETV5/ERM Antibody (NBP3-17656).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for ETV5/ERM Antibody (NBP3-17656) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ETV5/ERM Products
Research Areas for ETV5/ERM Antibody (NBP3-17656)
Find related products by research area.
|
Blogs on ETV5/ERM