ETV2/ER71 Antibody

Images

 
Western Blot: ETV2 Antibody [NBP1-97864] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clonality
Polyclonal
Host
Rabbit

Order Details

ETV2/ER71 Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human ETV2. Peptide sequence DTPTATAETCWKGTSSSLASFPQLDWGSALLHPEVPWGAEPDSQALPWSG.
Epitope
DTPTATAETCWKGTSSSLASFPQLDWGSALLHPEVPWGAEPDSQALPWSG
Clonality
Polyclonal
Host
Rabbit
Gene
ETV2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • ELISA 1:62500

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ETV2/ER71 Antibody

  • ER71
  • ER71MGC129835
  • ETS translocation variant 2
  • ets variant 2
  • Ets-related protein 71
  • ETSRP71
  • ETSRP71ets variant gene 2
  • ETV2/ER71
  • MGC129834

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01488
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-48693
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88080
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF313
Species: Hu
Applications: WB, Simple Western, IHC, Block
NB100-524
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-87925
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16500
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-84550
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo
NBP1-82581
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC
NB100-410
Species: Hu, Mu
Applications: WB, IP
AF3645
Species: Hu
Applications: WB, ICFlow
NBP1-97864
Species: Hu
Applications: WB, ELISA

Publications for ETV2/ER71 Antibody (NBP1-97864) (0)

There are no publications for ETV2/ER71 Antibody (NBP1-97864).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ETV2/ER71 Antibody (NBP1-97864) (0)

There are no reviews for ETV2/ER71 Antibody (NBP1-97864). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ETV2/ER71 Antibody (NBP1-97864) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ETV2/ER71 Antibody Products

Related Products by Gene

Bioinformatics Tool for ETV2/ER71 Antibody (NBP1-97864)

Discover related pathways, diseases and genes to ETV2/ER71 Antibody (NBP1-97864). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ETV2/ER71 Antibody (NBP1-97864)

Discover more about diseases related to ETV2/ER71 Antibody (NBP1-97864).
 

Pathways for ETV2/ER71 Antibody (NBP1-97864)

View related products by pathway.

Blogs on ETV2/ER71

There are no specific blogs for ETV2/ER71, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol ETV2
Entrez
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-97864 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought