ETV2/ER71 Antibody

Images

 
Western Blot: ETV2 Antibody [NBP1-97864] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ETV2/ER71 Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human ETV2. Peptide sequence DTPTATAETCWKGTSSSLASFPQLDWGSALLHPEVPWGAEPDSQALPWSG.
Epitope
DTPTATAETCWKGTSSSLASFPQLDWGSALLHPEVPWGAEPDSQALPWSG
Clonality
Polyclonal
Host
Rabbit
Gene
ETV2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • ELISA 1:62500

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ETV2/ER71 Antibody

  • ER71
  • ER71MGC129835
  • ETS translocation variant 2
  • ets variant 2
  • Ets-related protein 71
  • ETSRP71
  • ETSRP71ets variant gene 2
  • ETV2
  • MGC129834

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01488
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-37384
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
AF644
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-48693
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88080
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
AF313
Species: Hu
Applications: WB, Simple Western, IHC, Block
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-87926
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16500
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-84550
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
NBP1-82581
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NB100-410
Species: Hu, Mu
Applications: WB, IP
AF3645
Species: Hu
Applications: WB, CyTOF-ready, ICFlow

Publications for ETV2/ER71 Antibody (NBP1-97864) (0)

There are no publications for ETV2/ER71 Antibody (NBP1-97864).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ETV2/ER71 Antibody (NBP1-97864) (0)

There are no reviews for ETV2/ER71 Antibody (NBP1-97864). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ETV2/ER71 Antibody (NBP1-97864) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ETV2/ER71 Antibody Products

Related Products by Gene

Bioinformatics Tool for ETV2/ER71 Antibody (NBP1-97864)

Discover related pathways, diseases and genes to ETV2/ER71 Antibody (NBP1-97864). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ETV2/ER71 Antibody (NBP1-97864)

Discover more about diseases related to ETV2/ER71 Antibody (NBP1-97864).
 

Pathways for ETV2/ER71 Antibody (NBP1-97864)

View related products by pathway.

Blogs on ETV2/ER71

There are no specific blogs for ETV2/ER71, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ETV2/ER71 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ETV2
Entrez
Uniprot

Customers Who Bought This Also Bought