ETV2/ER71 Antibody


Western Blot: ETV2 Antibody [NBP1-97864] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA

Order Details

ETV2/ER71 Antibody Summary

Synthetic peptide directed towards the N terminal of human ETV2. Peptide sequence DTPTATAETCWKGTSSSLASFPQLDWGSALLHPEVPWGAEPDSQALPWSG.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • ELISA 1:62500

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ETV2/ER71 Antibody

  • ER71
  • ER71MGC129835
  • ETS translocation variant 2
  • ets variant 2
  • Ets-related protein 71
  • ETSRP71
  • ETSRP71ets variant gene 2
  • ETV2
  • MGC129834


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC, Block
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Mu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
Species: Hu
Applications: WB, Simple Western, ICC
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
Species: Hu, Mu
Applications: WB, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA

Publications for ETV2/ER71 Antibody (NBP1-97864) (0)

There are no publications for ETV2/ER71 Antibody (NBP1-97864).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ETV2/ER71 Antibody (NBP1-97864) (0)

There are no reviews for ETV2/ER71 Antibody (NBP1-97864). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ETV2/ER71 Antibody (NBP1-97864) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ETV2/ER71 Products

Bioinformatics Tool for ETV2/ER71 Antibody (NBP1-97864)

Discover related pathways, diseases and genes to ETV2/ER71 Antibody (NBP1-97864). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ETV2/ER71 Antibody (NBP1-97864)

Discover more about diseases related to ETV2/ER71 Antibody (NBP1-97864).

Pathways for ETV2/ER71 Antibody (NBP1-97864)

View related products by pathway.

Blogs on ETV2/ER71

There are no specific blogs for ETV2/ER71, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ETV2/ER71 Antibody and receive a gift card or discount.


Gene Symbol ETV2