ETV2/ER71 Antibody


Western Blot: ETV2 Antibody [NBP1-97864] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA

Order Details

ETV2/ER71 Antibody Summary

Synthetic peptide directed towards the N terminal of human ETV2. Peptide sequence DTPTATAETCWKGTSSSLASFPQLDWGSALLHPEVPWGAEPDSQALPWSG.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • ELISA 1:62500

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ETV2/ER71 Antibody

  • ER71
  • ER71MGC129835
  • ETS translocation variant 2
  • ets variant 2
  • Ets-related protein 71
  • ETSRP71
  • ETSRP71ets variant gene 2
  • ETV2
  • MGC129834


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC, Block
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
Species: Hu, Mu
Applications: WB, IP
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
Species: Hu
Applications: WB, ELISA

Publications for ETV2/ER71 Antibody (NBP1-97864) (0)

There are no publications for ETV2/ER71 Antibody (NBP1-97864).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ETV2/ER71 Antibody (NBP1-97864) (0)

There are no reviews for ETV2/ER71 Antibody (NBP1-97864). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ETV2/ER71 Antibody (NBP1-97864) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ETV2/ER71 Antibody Products

Related Products by Gene

Bioinformatics Tool for ETV2/ER71 Antibody (NBP1-97864)

Discover related pathways, diseases and genes to ETV2/ER71 Antibody (NBP1-97864). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ETV2/ER71 Antibody (NBP1-97864)

Discover more about diseases related to ETV2/ER71 Antibody (NBP1-97864).

Pathways for ETV2/ER71 Antibody (NBP1-97864)

View related products by pathway.

Blogs on ETV2/ER71

There are no specific blogs for ETV2/ER71, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our ETV2/ER71 Antibody and receive a gift card or discount.


Gene Symbol ETV2

Customers Who Bought This Also Bought