ETV2/ER71 Antibody - BSA Free

Western Blot: ETV2/ER71 Antibody [NBP1-97864] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ETV2/ER71 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the N terminal of human ETV2. Peptide sequence DTPTATAETCWKGTSSSLASFPQLDWGSALLHPEVPWGAEPDSQALPWSG. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ETV2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ETV2/ER71 Antibody - BSA Free

• ER71
• ER71MGC129835
• ETS translocation variant 2
• ets variant 2
• Ets-related protein 71
• ETSRP71
• ETSRP71ets variant gene 2
• ETV2
• MGC129834

Background

ETV2 binds to DNA sequences containing the consensus pentanucleotide 5'-CGGA[AT]-3'

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ETV2
• Uniprot:
  • NP_055024(Human)