ETEA Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ETEA Antibody [NBP2-57046] - Staining of human cell line MCF7 shows localization to lipid droplets.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ETEA Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MAAPEERDLTQEQTEKLLQFQDLTGIESMDQCRHTLEQHNWNIEAAVQDRLNEQEGVPSVFNPPPSRPLQVNTADHRIYSYVVSRPQPR
Specificity
Specificity of human ETEA antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAF2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ETEA Recombinant Protein Antigen (NBP2-57046PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ETEA Antibody

  • B17.2L
  • ETEAFAS-associated factor 2
  • expressed in T-cells and eosinophils in atopic dermatitis
  • Fas associated factor family member 2
  • KIAA0887UBX domain protein 3B
  • MMTN
  • NDUNDUFA12L
  • UBX domain containing 8
  • UBX domain-containing protein 3B
  • UBX domain-containing protein 8
  • UBXD8
  • UBXN3BProtein ETEA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-155
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1558
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-448
Species: Hu, Mu, Ca, ChHa
Applications: WB, ICC/IF, IHC, IHC-P
NB200-527
Species: Hu, Mu, Rt
Applications: WB, IP
NB100-1269
Species: Hu, Mu
Applications: WB, Flow, PEP-ELISA
NBP2-00990
Species: Hu, Mu, Rt, Ca, Pm, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB110-40591
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB120-11929
Species: Hu, Mu
Applications: WB, Flow
NBP2-43760
Species: Hu
Applications: WB, ICC/IF, IHC-Fr, IHC-P
NBP1-85785
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-45565
Species: Hu
Applications: WB, IHC
NBP2-93746
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
H00000439-M03
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi, S-ELISA
NBP1-31267
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-582
Species: Hu, Mu, Rt, Ca, Ch, SyHa, Ha, Pm
Applications: WB, Simple Western, IHC-Fr, KO

Publications for ETEA Antibody (NBP2-57046) (0)

There are no publications for ETEA Antibody (NBP2-57046).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ETEA Antibody (NBP2-57046) (0)

There are no reviews for ETEA Antibody (NBP2-57046). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ETEA Antibody (NBP2-57046) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ETEA Products

Bioinformatics Tool for ETEA Antibody (NBP2-57046)

Discover related pathways, diseases and genes to ETEA Antibody (NBP2-57046). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for ETEA Antibody (NBP2-57046)

View related products by pathway.

Blogs on ETEA

There are no specific blogs for ETEA, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ETEA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAF2