ERO1LB Antibody

Images

 
Western Blot: ERO1LB Antibody [NBP1-83961] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunohistochemistry-Paraffin: ERO1LB Antibody [NBP1-83961] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ERO1LB Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NLKRPCPFWAEDGHCSIKDCHVEPCPESKIPVGIKAGHSNKYLKMANNTKELEDCEQANKLGAINSTLSNQSKEAFIDWARYDDSRDHFCELDDE
Specificity
Specificity of human ERO1LB antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ERO1B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ERO1LB Protein (NBP1-83961PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ERO1LB Antibody

  • DKFZp779C1042
  • DKFZp779I0141
  • EC 1.8.4
  • EC 1.8.4.-
  • Endoplasmic oxidoreductin-1-like protein B
  • ERO1-L(beta)
  • ERO1-L-beta
  • ERO1-like beta (S. cerevisiae)
  • ERO1-like protein beta
  • FLJ11003
  • oxidoreductin-1-L-beta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2525
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
H00005034-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-37761
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-517
Species: Hu, Mu, Rt, Po, Bv, Ha, Pm, Pm, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP, B/N, KD
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-88361
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
H00023071-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP, S-ELISA
NB100-74510
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-182
Species: Hu, Mu, Rt, Av, Ca, Ma, Pm, Ze
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-P, IP, RNAi, KD, KO
NBP1-89394
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-28641
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC, IHC-P
NBP1-98511
Species: Hu
Applications: WB
NB110-41622
Species: Hu, Mu, Rt, Po, Bv, Ch, Gt, Xp
Applications: WB, IHC, IHC-P

Publications for ERO1LB Antibody (NBP1-83961) (0)

There are no publications for ERO1LB Antibody (NBP1-83961).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ERO1LB Antibody (NBP1-83961) (0)

There are no reviews for ERO1LB Antibody (NBP1-83961). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ERO1LB Antibody (NBP1-83961) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ERO1LB Products

Bioinformatics Tool for ERO1LB Antibody (NBP1-83961)

Discover related pathways, diseases and genes to ERO1LB Antibody (NBP1-83961). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ERO1LB Antibody (NBP1-83961)

Discover more about diseases related to ERO1LB Antibody (NBP1-83961).
 

Pathways for ERO1LB Antibody (NBP1-83961)

View related products by pathway.

PTMs for ERO1LB Antibody (NBP1-83961)

Learn more about PTMs related to ERO1LB Antibody (NBP1-83961).

Blogs on ERO1LB

There are no specific blogs for ERO1LB, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ERO1LB Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ERO1B