ERLEC1 Antibody

Images

 
Western Blot: ERLEC1 Antibody [NBP1-86803] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: ERLEC1 Antibody [NBP1-86803] - Staining of human cerebellum shows strong nuclear/nucleolar and cytoplasmic positivity in Purkinje cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ERLEC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SDDIPFRVNWPGTEFSLPTTGVLYKEDNYVIMTTAHKEKYKCILPLVTSGDEEEEKDYKGPNPRELLEPLFKQSSCSYRIESYWTYEVCHGKH
Specificity
Specificity of human ERLEC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ERLEC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ERLEC1 Protein (NBP1-86803PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ERLEC1 Antibody

  • C20orf30
  • C2orf30
  • CL24936
  • CL25084
  • endoplasmic reticulum lectin 1
  • ER lectin
  • erlectin 1
  • ERLECTIN
  • XTP3-B
  • XTP3TPBchromosome 2 open reading frame 30
  • XTP3-transactivated gene B protein
  • XTP3-transactivated protein B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

BC100-520
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-2526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KO
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
AF1543
Species: Hu
Applications: WB, IHC
NBP1-81623
Species: Hu
Applications: IHC, IHC-P
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-78444
Species: Hu, Mu, Rt, Pm, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01346
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-326
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-43303
Species: Mu
Applications: ELISA, Flow, IHC, IHC-Fr
NBP1-54633
Species: Hu
Applications: WB, IHC

Publications for ERLEC1 Antibody (NBP1-86803) (0)

There are no publications for ERLEC1 Antibody (NBP1-86803).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ERLEC1 Antibody (NBP1-86803) (0)

There are no reviews for ERLEC1 Antibody (NBP1-86803). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ERLEC1 Antibody (NBP1-86803) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ERLEC1 Antibody (NBP1-86803)

Discover related pathways, diseases and genes to ERLEC1 Antibody (NBP1-86803). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ERLEC1 Antibody (NBP1-86803)

Discover more about diseases related to ERLEC1 Antibody (NBP1-86803).
 

Pathways for ERLEC1 Antibody (NBP1-86803)

View related products by pathway.

Blogs on ERLEC1

There are no specific blogs for ERLEC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ERLEC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ERLEC1