| Description | Novus Biologicals Knockout (KO) Validated Rabbit ERK2 Antibody - BSA Free (NBP3-02973) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human ERK2 (NP_002736.3). LNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MAPK1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.09% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for ERK2 Antibody (NBP3-02973)Find related products by research area.
|
|
The effects of curcumin on IKB Alpha and the NFkB signaling pathway The IKK complex, or inhibitor of NFkB kinase, is composed of IKK alpha and IKK beta. These kinases are at the core of the NFkB signaling cascade. The NFkB family is made up of transcription factors that are kept inactive in the cytoplasm through... Read full blog post. |
|
The c-Myc Antibody: A Major Tool in Cancer Research C-Myc is a widely expressed transcription factor, regulating cellular differentiation, proliferation, cell cycle progression and pro-apoptotic gene expression. The c-Myc antibody is widely used in cancer research, as a number of human tumors have been... Read full blog post. |
|
Use Of c-Myc Antibodies In Non-Invasive Cancer Studies Novus Biologicals specializes in offering top quality antibody reagents to many of the transcription factor proteins that are widely expressed in cancer cells.C-Myc is one of several transcription factor proteins covered by our antibody catalog. Enc... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MAPK1 |