ERK1/2 Antibody - Azide and BSA Free

Western Blot: ERK1/2 Antibody [NBP3-05645] - Western blot analysis of extracts of various cell lines, using ERK1/2 antibody (NBP3-05645) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Immunocytochemistry/ Immunofluorescence: ERK1/2 Antibody - Azide and BSA Free [NBP3-05645] - Confocal immunofluorescence analysis of Hela cells using ERK1/2 Rabbit pAb at dilution of 1:200. Blue: DAPI for nuclear staining.

Immunocytochemistry/Immunofluorescence: ERK1/2 Antibody [NBP3-05645] - Immunofluorescence analysis of NIH-3T3 cells using ERK1/2 Polyclonal Antibody (NBP3-05645) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunocytochemistry/Immunofluorescence: ERK1/2 Antibody [NBP3-05645] - Confocal immunofluorescence analysis of Hela cells using ERK1/2 Polyclonal Antibody (NBP3-05645) at dilution of 1:200. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ERK1/2 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit ERK1/2 Antibody - Azide and BSA Free (NBP3-05645) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human ERK1/2 (NP_620407.1/NP_002737.2). LNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MAPK3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:100 - 1:200
  • Western Blot 1:1000 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for ERK1/2 Antibody - Azide and BSA Free

• EC 2.7.11
• ERK-1
• ERK1p44-MAPK
• ERT2
• Extracellular signal-regulated kinase 1
• extracellular signal-related kinase 1
• HS44KDAP
• HUMKER1A
• Insulin-stimulated MAP2 kinase
• MAP kinase 1
• MAP kinase 3
• MAP kinase isoform p44
• MAPK 1
• MAPK 3
• MGC20180
• Microtubule-associated protein 2 kinase
• Mitogen-activated protein kinase 1
• mitogen-activated protein kinase 3
• p44erk1
• p44-ERK1
• p44mapk
• PRKM3EC 2.7.11.24

Background

The extracellular signal-regulated kinases 1 and 2 (ERK1 and ERK2), also called p44 and p42 MAP kinases, are members of the Mitogen Activated Protein Kinase (MAPK) family of proteins found in all eukaryotes. Because the 44 kDa ERK1 and the 42 kDa ERK2 are highly homologous and both function in the same protein kinase cascade, the two proteins are often referred to collectively as ERK1/2 or p44/p42 MAP kinase (1). They are both located in the cytosol and mitochondria (2). While the role of cytosol ERK1/2 is well studied and involved in multiple cellular functions (2), the role of mitochondrial ERK1/2 remains poorly understood. Both ERK 1 and 2 are activated by MEK1 or MEK2, by dual phosphorylation of a threonine and tyrosine residue in the activation loop (TEY motif) (1, 3). Either phosphorylation alone can induce an electrophoretic mobility shift, but both are required for activation of the kinase. This dual phosphorylation is efficiently detected by phosphorylation state-specific antibody directed to the pTEpY motif. Once activated, MAP kinases phosphorylate a broad spectrum of substrates, including cytoskeletal proteins, translation regulators, transcription factors, and the Rsk family of protein kinases (4). ERK1/2 activation is generally thought to confer a survival advantage to cells (5); however there is increasing evidence that suggests that the activation of ERK1/2 also contributes to cell death under certain conditions (5). ERK1/2 also is activated in neuronal and renal epithelial cells upon exposure to oxidative stress and toxicants or deprivation of growth factors, and inhibition of the ERK pathway blocks apoptosis (5).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: MAPK3