ERK1/2 Antibody - Azide and BSA Free

Images

 
Western Blot: ERK1/2 Antibody [NBP3-05645] - Western blot analysis of extracts of various cell lines, using ERK1/2 antibody (NBP3-05645) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 ...read more
Immunocytochemistry/ Immunofluorescence: ERK1/2 Antibody - Azide and BSA Free [NBP3-05645] - Confocal immunofluorescence analysis of Hela cells using ERK1/2 Rabbit pAb at dilution of 1:200. Blue: DAPI for nuclear ...read more
Immunocytochemistry/ Immunofluorescence: ERK1/2 Antibody [NBP3-05645] - Immunofluorescence analysis of NIH-3T3 cells using ERK1/2 Polyclonal Antibody (NBP3-05645) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear ...read more
Immunocytochemistry/ Immunofluorescence: ERK1/2 Antibody [NBP3-05645] - Confocal immunofluorescence analysis of Hela cells using ERK1/2 Polyclonal Antibody (NBP3-05645) at dilution of 1:200. Blue: DAPI for nuclear ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
Azide and BSA Free

Order Details

ERK1/2 Antibody - Azide and BSA Free Summary

Immunogen
A synthetic peptide corresponding to a sequence within amino acids 200-300 of human ERK1/2 (NP_620407.1/NP_002737.2). LNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAPK3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 1:100 - 1:200
  • Western Blot 1:1000 - 1:2000

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ERK1/2 Antibody - Azide and BSA Free

  • EC 2.7.11
  • ERK-1
  • ERK1p44-MAPK
  • ERT2
  • Extracellular signal-regulated kinase 1
  • extracellular signal-related kinase 1
  • HS44KDAP
  • HUMKER1A
  • Insulin-stimulated MAP2 kinase
  • MAP kinase 1
  • MAP kinase 3
  • MAP kinase isoform p44
  • MAPK 1
  • MAPK 3
  • MGC20180
  • Microtubule-associated protein 2 kinase
  • Mitogen-activated protein kinase 1
  • mitogen-activated protein kinase 3
  • p44erk1
  • p44-ERK1
  • p44mapk
  • PRKM3EC 2.7.11.24

Background

The extracellular signal-regulated kinases 1 and 2 (ERK1 and ERK2), also called p44 and p42 MAP kinases, are members of the Mitogen Activated Protein Kinase (MAPK) family of proteins found in all eukaryotes. Because the 44 kDa ERK1 and the 42 kDa ERK2 are highly homologous and both function in the same protein kinase cascade, the two proteins are often referred to collectively as ERK1/2 or p44/p42 MAP kinase (1). They are both located in the cytosol and mitochondria (2). While the role of cytosol ERK1/2 is well studied and involved in multiple cellular functions (2), the role of mitochondrial ERK1/2 remains poorly understood. Both ERK 1 and 2 are activated by MEK1 or MEK2, by dual phosphorylation of a threonine and tyrosine residue in the activation loop (TEY motif) (1, 3). Either phosphorylation alone can induce an electrophoretic mobility shift, but both are required for activation of the kinase. This dual phosphorylation is efficiently detected by phosphorylation state-specific antibody directed to the pTEpY motif. Once activated, MAP kinases phosphorylate a broad spectrum of substrates, including cytoskeletal proteins, translation regulators, transcription factors, and the Rsk family of protein kinases (4). ERK1/2 activation is generally thought to confer a survival advantage to cells (5); however there is increasing evidence that suggests that the activation of ERK1/2 also contributes to cell death under certain conditions (5). ERK1/2 also is activated in neuronal and renal epithelial cells upon exposure to oxidative stress and toxicants or deprivation of growth factors, and inhibition of the ERK pathway blocks apoptosis (5).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP1-47833
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
AF8691
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
H00005706-M02
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, KD, WB
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-37568
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-00764
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
H00010598-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP1-81575
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-68874
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
236-EG
Species: Hu
Applications: BA
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Publications for ERK1/2 Antibody (NBP3-05645) (0)

There are no publications for ERK1/2 Antibody (NBP3-05645).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ERK1/2 Antibody (NBP3-05645) (0)

There are no reviews for ERK1/2 Antibody (NBP3-05645). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ERK1/2 Antibody (NBP3-05645) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ERK1/2 Products

Array NBP3-05645

Research Areas for ERK1/2 Antibody (NBP3-05645)

Find related products by research area.

Blogs on ERK1/2.

TGF-beta for treating degenerative intervertebral disc disease
By Jamshed Arslan Pharm.D. Our upright posture and balance depend on a jelly-like material, called nucleus pulposus (NP), in the middle of intervertebral discs. NP cells protect us from disc degeneration by maintain...  Read full blog post.

SUCNR1/GPR91 - a potential role in renovascular hypertension
SUCNR1 is the cognate receptor for the Kreb's citric acid cycle intermediate succinate. It is of interest to scientists because it is involved in not only energy metabolism but possibly also in renovascular hypertension, a condition linked to diabe...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ERK1/2 Antibody - Azide and BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol MAPK3