ERAB Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

ERAB Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HSD17B10.
  
  

  Source: E. coli

  Amino Acid Sequence: EAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQA

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: HSD17B10
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90333.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 30 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ERAB Recombinant Protein Antigen

• 17-beta-HSD 10
• 17-beta-hydroxysteroid dehydrogenase 10
• 17b-HSD10
• 3-hydroxy-2-methylbutyryl-CoA dehydrogenase
• ABAD
• amyloid-beta peptide binding alcohol dehydrogenase
• CAMR
• DUPXp11.22
• EC 1.1.1.178
• EC 1.1.1.35
• Endoplasmic reticulum-associated amyloid beta-peptide-binding protein
• ERAB3-hydroxyacyl-CoA dehydrogenase type-2
• HADH2AB-binding alcohol dehydrogenase
• hydroxyacyl-Coenzyme A dehydrogenase, type II, hydroxyacyl-Coenzyme Adehydrogenase, type II
• hydroxysteroid (17-beta) dehydrogenase 10
• mental retardation, X-linked, syndromic 10
• MHBD
• Mitochondrial ribonuclease P protein 2,3-hydroxyacyl-CoA dehydrogenase type II
• Mitochondrial RNase P protein 2
• MRPP2HCD2
• MRX17
• MRX31
• MRXS10
• SCHAD
• SDR5C1
• short chain dehydrogenase/reductase family 5C, member 1
• short chain L-3-hydroxyacyl-CoA dehydrogenase type 2
• short chain type dehydrogenase/reductase XH98G2
• Short-chain type dehydrogenase/reductase XH98G2
• Type II HADH
• XH98G2

Background

ERAB encodes 3-hydroxyacyl-CoA dehydrogenase type II, a member of the short-chain dehydrogenase/reductase superfamily. The gene product is a mitochondrial protein that catalyzes the oxidation of a wide variety of fatty acids, alcohols, and steroids. The protein has been implicated in the development of Alzheimer's disease, and mutations in the gene are the cause of 2-methyl-3-hydroxybutyryl-CoA dehydrogenase deficiency (MHBD). Several alternatively spliced transcript variants have been identified, but the full-length nature of only two transcript variants has been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: HSD17B10