Home » epithelial Sodium Channel gamma » epithelial Sodium Channel gamma Antibodies » epithelial Sodium Channel gamma Antibody

epithelial Sodium Channel gamma Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: epithelial Sodium Channel gamma Antibody [NBP2-56532] - Staining of human cell line RT4 shows localization to nucleoplasm & plasma membrane.
Immunocytochemistry/ Immunofluorescence: epithelial Sodium Channel gamma Antibody [NBP2-56532] - Staining of human cell line RT4 shows localization to nucleoplasm & plasma membrane.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

epithelial Sodium Channel gamma Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SEYGLQVILYINEEEYNPFLVSSTGAKVIIHRQDEYPFVEDVGTEIETAMVTSIGMHLTESFKLSEPYSQ
Specificity
Specificity of human epithelial Sodium Channel gamma antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SCNN1G
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
epithelial Sodium Channel gamma Recombinant Protein Antigen (NBP2-56532PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for epithelial Sodium Channel gamma Antibody

  • amiloride-sensitive epithelial sodium channel gamma subunit
  • amiloride-sensitive sodium channel gamma-subunit
  • BESC3
  • ENaC gamma subunit
  • ENaCG
  • ENaCgamma
  • Epithelial Na(+) channel subunit gamma
  • gamma-ENaC
  • gamma-NaCH
  • Nonvoltage-gated sodium channel 1 subunit gamma
  • PHA1
  • SCNEGamiloride-sensitive sodium channel subunit gamma
  • sodium channel, nonvoltage-gated 1, gamma

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

epithelial Sodium
Channel beta Antibody ...
NBP2-59383
Western Blot: epithelial Sodium Channel beta Antibody (14E10) [NBP2-59383] - Analysis of Mouse Whole kidney homogenates showing detection of ~85kDa ENaC alpha protein using Mouse Anti-ENaC alpha Monoclonal Antibody, Clone 14E10. Lane 1: Molecular Weight Ladder (MW). Lane 2: Low-salt diet. Lane 3: Normal-salt diet. Load: 20 ug. Primary Antibody: Mouse Anti-ENaC alpha Monoclonal Antibody at 1:1000. Wredicted/Observed Size: ~85kDa.
Immunohistochemistry: epithelial Sodium Channel beta Antibody (14E10) [NBP2-59383] - Tissue: Kidney. Species: Rat. Fixation: Paraffin-embedded formalin-fixed. Primary Antibody: Mouse Anti-ENaC alpha Monoclonal Antibody at 1:100. Secondary Antibody: Goat Anti-Mouse ATTO 488 (green). Localization: Intercalated cells. Aquaporin 2 Antibody staining in red.
Species: Mu, Rt
Applications: WB, IHC
epithelial Sodium
Channel alpha Antibod ...
NB100-74357
Western Blot: epithelial Sodium Channel alpha Antibody [NB100-74357] - Analysis of 25 ug of Daudi (lane 1) and mouse brain (lane 2) cell lysates onto an SDS polyacrylamide gel.
Immunocytochemistry/Immunofluorescence: epithelial Sodium Channel alpha Antibody [NB100-74357] - performed using 70% confluent log phase HEK-293 cells. The cells were fixed with 4% paraformaldehyde for 10 minutes, permeabilized with 0.1% Triton(tm) X-100 for 10 minutes, and blocked with 1% BSA for 1 hour at room temperature. The cells were labeled with alpha ENaC Rabbit Polyclonal Antibody at 2 ug/ml in 0.1% BSA and incubated for 3 hours at room temperature and then labeled with Goat anti-Rabbit IgG (H+L) Superclonal(tm) Secondary Antibody, Alexa Fluor(R) 488 conjugate a dilution of 1:2000 for 45 minutes at room temperature (Panel a: green). Nuclei (Panel b: blue) were stained with SlowFade(R) Gold Antifade Mountant with DAPI. F-actin (Panel c: red) was stained with Alexa Fluor(R) 555 Rhodamine Phalloidin (1:300). Panel d represents the merged image showing cytoplasmic localization. Panel e shows the no primary antibody control. The images were captured at 60X magnification.
Immunocytochemistry/Immunofluorescence: epithelial Sodium Channel alpha Antibody [NB100-74357] - performed using 70% confluent log phase HEK 293 cells. The cells were fixed with 4% paraformaldehyde for 10 minutes, permeabilized with 0.1% Triton(tm) X-100 for 10 minutes, and blocked with 1% BSA for 1 hour at room temperature. The cells were labeled with alpha ENaC Rabbit Polyclonal Antibody at 2ug/ml in 0.1% BSA and incubated for 3 hours at room temperature and then labeled with Goat anti-Rabbit IgG (H+L) Superclonal(tm) Secondary Antibody, Alexa Fluor(R) 488 conjugate) at a dilution of 1:2000 for 45 minutes at room temperature (Panel a: green). Nuclei (Panel b: blue) were stained with SlowFade(R) Gold Antifade Mountant with DAPI. F-actin (Panel c: red) was stained with Alexa Fluor(R) 555 Rhodamine Phalloidin (1:300). Panel d represents the merged image showing cytoplasmic localization. Panel e shows the no primary antibody control. The images were captured at 60X magnification.
(4 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
SLC12A3 Antibody
NBP1-44270
Western Blot: SLC12A3 Antibody [NBP1-44270] - analysis of Rat tissue lysates showing detection of NCC protein using Rabbit Anti-NCC Polyclonal Antibody. Primary Antibody: Rabbit Anti-NCC Polyclonal Antibody at 1:1000.
Immunocytochemistry/Immunofluorescence: SLC12A3 Antibody [NBP1-44270] - Tissue: kidney tissue. Species: Rat. Primary Antibody: Rabbit Anti-NCC Polyclonal Antibody at 1:200. Secondary Antibody: FITC Goat Anti-Rabbit (green).
Immunocytochemistry/Immunofluorescence: SLC12A3 Antibody [NBP1-44270] - analysis of NCC in rat kidney tissues, showing a 1:200 dilution of this antibody
(1 Publication)
Species: Mu, Rt
Applications: WB, EM, ICC/IF, IHC, IHC-P
CFTR Antibody
(24-1) [Unconjugated] ...
MAB25031
CFTR was detected in immersion fixed paraffin-embedded sections of human placenta using 8 µg/mL Mouse Anti-Human CFTR C‑Terminus Monoclonal Antibody (Catalog # MAB25031) overnight at 4 °C. Tissue was stained with the Anti-Mouse HRP-AEC Cell & Tissue Staining Kit (red; Catalog # CTS003) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
CFTR was detected in immersion fixed paraffin-embedded sections of human placenta using Mouse Anti-Human CFTR C-Terminus Monoclonal Antibody (Catalog # MAB25031) at 25 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(11 Reviews)
(41 Publications)
Species: Hu
Applications: WB, IHC, IP
Mineralocorticoid
R/NR3C2 Antibody (H10 ...
NB300-562
Western Blot: Mineralocorticoid R/NR3C2 Antibody (H10E4C9F) [NB300-562] - Analysis of Mineralocorticoid Receptor.
Immunocytochemistry/Immunofluorescence: Mineralocorticoid R/NR3C2 Antibody (H10E4C9F) [NB300-562] - Mineralocorticoid Receptor staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing Mineralocorticoid Receptor at a dilution of 1:20-1:200 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
Immunohistochemistry-Paraffin: Mineralocorticoid R/NR3C2 Antibody (H10E4C9F) [NB300-562] - Both normal and cancer biopsies of deparaffinized Human colon carcinoma tissues.
(1 Publication)
Species: Hu, Mu, Rt, Ch, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, B/N
NKCC2/SLC12A1
Antibody
NBP1-80993
Western Blot: NKCC2/SLC12A1 Antibody [NBP1-80993] - Western blot experiments were performed to determine the protein expression in eight corresponding normal (N) and clear cell renal cell carcinoma (T) tissue. NPTX2 was increased in tumor tissue, whereas FXYD4, KNG1, SLC12A1 and SLC6A3 were decreased in tumors. NDUF4AL2 levels were similar, but the bands were of different size in tumor and normal samples Image collected and cropped by CiteAb from the following publication (http://molecular-cancer.biomedcentral.com/articles/10.1186/s12943-016-0495-5), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: NKCC2/SLC12A1 Antibody [NBP1-80993] - Staining of human cell line RPTEC TERT1 shows localization to nucleus & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NKCC2/SLC12A1 Antibody [NBP1-80993] - Analysis in human kidney and pancreas tissues using NBP1-80993 antibody. Corresponding SLC12A1 RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
SGK1 Antibody
(SC05-71)
NBP2-67561
Western Blot: SGK1 Antibody (SC05-71) [NBP2-67561] - Analysis of SGK1 on human kidney lysates using anti-SGK1 antibody at 1/1,000 dilution.
Immunohistochemistry-Paraffin: SGK1 Antibody (SC05-71) [NBP2-67561] - Analysis of paraffin-embedded mouse liver tissue using anti-SGK1 antibody. Counter stained with hematoxylin.
Flow Cytometry: SGK1 Antibody (SC05-71) [NBP2-67561] - Analysis of 293 cells with SGK1 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, IP
Aquaporin-2
Antibody
NB110-74682
Western Blot: Aquaporin-2 Antibody [NB110-74682] - Detection of Aquaporin 2 in rat kidney extracts. Cortex (CX), Outer Medulla (OM), Inner Medulla Base (IMB), Inner Medulla Papilla (IMP).
Immunocytochemistry/Immunofluorescence: Aquaporin-2 Antibody [NB110-74682] - Staining of mpkCCD cell line
Immunohistochemistry-Paraffin: Aquaporin-2 Antibody [NB110-74682] - Analysis of FFPE human kidney using 1:100 conc. of Aquaporin-2 antibody on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images was performed using Aperio AT2 (Leica Biosystems). Lumenal staining of Aquaporin-2 in scattered tubules was observed. Staining was performed by Histowiz.
(24 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NHE3/SLC9A3 [p
Ser552] Antibody (14D
NB110-81529
Western Blot: NHE3/SLC9A3 [p Ser552] Antibody (14D5) [NB110-81529] - Detection of NHE3 [p Ser552] in human kidney lysate.
Immunohistochemistry: NHE3/SLC9A3 [p Ser552] Antibody (14D5) [NB110-81529] - Mouse intestine, image courtesy of verified customer review.
Simple Western: NHE3/SLC9A3 [p Ser552] Antibody (14D5) [NB110-81529] - Simple Western lane view shows a specific band for NHE3 in 0.5 mg/ml of Hek293 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
(1 Review)
(15 Publications)
Species: Hu, Mu, Rt, Po, Ma-Op, Pm, Rb
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IP, KD, KO
Recombinant Human
ACCN5 GST (N-Term) Pr ...
H00051802-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
KCNJ1 Antibody
NBP1-82874
Immunohistochemistry-Paraffin: KCNJ1 Antibody [NBP1-82874] - Staining of human lymph node shows low expression as expected.
Immunohistochemistry-Paraffin: KCNJ1 Antibody [NBP1-82874] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: KCNJ1 Antibody [NBP1-82874] - Staining in human kidney and lymph node tissues using anti-KCNJ1 antibody. Corresponding KCNJ1 RNA-seq data are presented for the same tissues.
(2 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
RUNX2/CBFA1
Antibody
NBP1-77461
Immunohistochemistry-Paraffin: RUNX2/CBFA1 Antibody [NBP1-77461] - Vascularization of mineralized cell-laden collagen and interaction with prostate cancer cells. HUVECs formed endothelial networks that were supported by SMA-expressing hMSCs (scale bar: 50m) and were also positive for CD31 (scale bar: 400m). The remainder of hMSCs expressed RUNX2 as a marker for osteogenic differentiation (scale bar: 50m). Rapid fabrication of vascularized and innervated cell-laden bone models with biomimetic intrafibrillar collagen mineralization. Nat Commun (2019)
Immunocytochemistry/Immunofluorescence: RUNX2/CBFA1 Antibody [NBP1-77461] - RUNX2 antibody was tested in HeLa cells with FITC (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
Immunohistochemistry-Paraffin: RUNX2/CBFA1 Antibody [NBP1-77461] - Characterization of TLC cultured in chondrogenic pellets. Gene expression of TLC cultured four weeks in chondrogenic pellets or in cell monolayer in control medium: levels of expression of osteoblast markers (1), chondrocyte markers (2) and tenocyte markers (3) (N = 3) assessed by qPCR.* =0.05. Rotator Cuff Tenocytes Differentiate into Hypertrophic Chondrocyte-Like Cells to Produce Calcium Deposits in an Alkaline Phosphatase-Dependent Manner. J Clin Med (2019)
(9 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
ERK1 Antibody (1E5)
NBP2-22203
Western Blot: ERK1 Antibody (1E5) [NBP2-22203] - Western blot analysis of whole cell lysates from (1) MCF7 (2) NIH3T3 cell lines using ERK1 antibody (clone 1E5) at 1:1000 dilution. The signal was developed using HRP labeled goat-anti Mouse secondary antibody with ECL based detection.
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Immunohistochemical analysis of paraffin-embedded breast cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Renin Antibody
AF4090
Renin was detected in immersion fixed paraffin-embedded sections of human kidney using Sheep Anti-Human Renin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4090) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Renin was detected in immersion fixed paraffin-embedded sections of human kidney array using Sheep Anti-Human Renin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4090) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(2 Publications)
Species: Hu
Applications: WB, IHC, IP, Neut
Recombinant Human
NEDD4L GST (N-Term) P ...
H00023327-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
(3 Publications)
Species: Hu
Angiotensin II/III
Antibody (Ang II E7 ( ...
NB100-62346
Western Blot: Angiotensin II/III Antibody (Ang II E7 (BGN/KA/4L)) [NB100-62346] - Protein expressions of intrarenal RAS components in two groups of mice. Western blot analysis for protein expressions of intrarenal RAS components in the two groups of mice. Image collected and cropped by CiteAb from the following publication (lipidworld.biomedcentral.com/articles/10.1186/1476-511X-12-49), licensed under a CC-BY licence.
Immunohistochemistry: Angiotensin II/III Antibody (Ang II E7 (BGN/KA/4L)) [NB100-62346] - Protein expressions of intrarenal RAS components in two groups of mice. (A) Immunohistochemical analysis of intrarenal RAS expression position in the two groups of mice. AGT immunoreactivity in the proximal tubular cells, Ang II immunoreactivity in both glomerular and tubular cells, renin immunoreactivity in juxtaglomerular apparatus cells, ACE immunoreactivity in brush border membranes of proximal tubules as well as AT1 and AT2 immunoreactivity in the proximal tubules were increased in the HF group when compared to the control group. Image collected and cropped by CiteAb from the following publication (lipidworld.biomedcentral.com/articles/10.1186/1476-511X-12-49), licensed under a CC-BY licence.
Western Blot: Angiotensin II/III Antibody (Ang II E7 (BGN/KA/4L)) [NB100-62346] - Evaluation of angiotensis II expression in untreated UUO rat kidneys and UUO rat kidneys treated with Ang-(1-7).
(13 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
ERMAP Antibody
AF4928
K562 human chronic myelogenous leukemia cell line was stained with Goat Anti-Human ERMAP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4928, filled histogram) or control antibody (Catalog # AB-108-C, open histogram), followed by Allophycocyanin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0108).
Species: Hu
Applications: WB, Flow, CyTOF-ready
epithelial Sodium
Channel gamma Antibod ...
NBP2-56532
epithelial Sodium Channel gamma Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for epithelial Sodium Channel gamma Antibody (NBP2-56532) (0)

There are no publications for epithelial Sodium Channel gamma Antibody (NBP2-56532).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for epithelial Sodium Channel gamma Antibody (NBP2-56532) (0)

There are no reviews for epithelial Sodium Channel gamma Antibody (NBP2-56532). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for epithelial Sodium Channel gamma Antibody (NBP2-56532) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional epithelial Sodium Channel gamma Products

Bioinformatics Tool for epithelial Sodium Channel gamma Antibody (NBP2-56532)

Discover related pathways, diseases and genes to epithelial Sodium Channel gamma Antibody (NBP2-56532). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for epithelial Sodium Channel gamma Antibody (NBP2-56532)

Discover more about diseases related to epithelial Sodium Channel gamma Antibody (NBP2-56532).
 

Pathways for epithelial Sodium Channel gamma Antibody (NBP2-56532)

View related products by pathway.

PTMs for epithelial Sodium Channel gamma Antibody (NBP2-56532)

Learn more about PTMs related to epithelial Sodium Channel gamma Antibody (NBP2-56532).

Blogs on epithelial Sodium Channel gamma

There are no specific blogs for epithelial Sodium Channel gamma, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our epithelial Sodium Channel gamma Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol SCNN1G