epithelial Sodium Channel gamma Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: epithelial Sodium Channel gamma Antibody [NBP2-56532] - Staining of human cell line RT4 shows localization to nucleoplasm & plasma membrane.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

epithelial Sodium Channel gamma Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SEYGLQVILYINEEEYNPFLVSSTGAKVIIHRQDEYPFVEDVGTEIETAMVTSIGMHLTESFKLSEPYSQ
Specificity
Specificity of human epithelial Sodium Channel gamma antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SCNN1G
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
epithelial Sodium Channel gamma Recombinant Protein Antigen (NBP2-56532PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for epithelial Sodium Channel gamma Antibody

  • amiloride-sensitive epithelial sodium channel gamma subunit
  • amiloride-sensitive sodium channel gamma-subunit
  • BESC3
  • ENaC gamma subunit
  • ENaCG
  • ENaCgamma
  • Epithelial Na(+) channel subunit gamma
  • gamma-ENaC
  • gamma-NaCH
  • Nonvoltage-gated sodium channel 1 subunit gamma
  • PHA1
  • SCNEGamiloride-sensitive sodium channel subunit gamma
  • sodium channel, nonvoltage-gated 1, gamma

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-59383
Species: Mu, Rt
Applications: WB, IHC
NB100-74357
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-44270
Species: Mu, Rt
Applications: WB, EM, ICC/IF, IHC, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP
NB300-562
Species: Hu, Mu, Rt, Ch, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, B/N
NBP1-80993
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67561
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, IP
NB110-74682
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-81529
Species: Hu, Mu, Rt, Po, Ma-Op, Pm, Rb
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IP, KD, KO
NBP1-82874
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
NBP1-77461
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
NB100-62346
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-56532
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for epithelial Sodium Channel gamma Antibody (NBP2-56532) (0)

There are no publications for epithelial Sodium Channel gamma Antibody (NBP2-56532).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for epithelial Sodium Channel gamma Antibody (NBP2-56532) (0)

There are no reviews for epithelial Sodium Channel gamma Antibody (NBP2-56532). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for epithelial Sodium Channel gamma Antibody (NBP2-56532) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional epithelial Sodium Channel gamma Products

Bioinformatics Tool for epithelial Sodium Channel gamma Antibody (NBP2-56532)

Discover related pathways, diseases and genes to epithelial Sodium Channel gamma Antibody (NBP2-56532). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for epithelial Sodium Channel gamma Antibody (NBP2-56532)

Discover more about diseases related to epithelial Sodium Channel gamma Antibody (NBP2-56532).
 

Pathways for epithelial Sodium Channel gamma Antibody (NBP2-56532)

View related products by pathway.

PTMs for epithelial Sodium Channel gamma Antibody (NBP2-56532)

Learn more about PTMs related to epithelial Sodium Channel gamma Antibody (NBP2-56532).

Blogs on epithelial Sodium Channel gamma

There are no specific blogs for epithelial Sodium Channel gamma, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our epithelial Sodium Channel gamma Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SCNN1G