epithelial Sodium Channel alpha Recombinant Protein Antigen

Images

 
There are currently no images for epithelial Sodium Channel alpha Protein (NBP1-84846PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

epithelial Sodium Channel alpha Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SCNN1A.

Source: E. coli

Amino Acid Sequence: RYPEIKEELEELDRITEQTLFDLYKYSSFTTLVAGSRSRRDLRGTLPHPLQRLRVPPPPHGARRARSVASSLRDNNPQVDWKDWKIGFQL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SCNN1A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84846.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for epithelial Sodium Channel alpha Recombinant Protein Antigen

  • alpha ENaC-2
  • Alpha-ENaC
  • Alpha-NaCH
  • amiloride-sensitive epithelial sodium channel alpha subunit
  • amiloride-sensitive sodium channel subunit alpha 2
  • amiloride-sensitive sodium channel subunit alpha
  • BESC2
  • ENaCA
  • ENaCalpha
  • Epithelial Na(+) channel subunit alpha
  • epithelial Sodium Channel alpha
  • FLJ21883
  • nasal epithelial sodium channel alpha subunit
  • Nonvoltage-gated sodium channel 1 subunit alpha
  • SCNEA
  • SCNN1
  • SCNN1A
  • sodium channel, nonvoltage-gated 1 alpha

Background

Epithelial Sodium Channel alpha (SCNN1A) is a subunit of the epithelial sodium channel (ENaC). ENac has high sodium selectivity, low conductance, and amiloride sensitivity. The functional channel of ENaC is composed of at least 3 subunits, alpha (SCNN1A), beta (SCNN1B), and gamma (SCNN1G). The 3 subunits show sequence similarities to one another, indicating descent from a common ancestral gene. Each encodes a protein containing 2 transmembrane domains, with intracellular amino and carboxyl termini. The alpha subunit supports sodium conductance when expressed alone; the beta and gamma subunits do not support sodium conductance by themselves, but greatly augment the channel activity when expressed in conjunction with the alpha subunit. ENaC in the kidney, lung and colon plays an essential role in trans- epithelial sodium and fluid balance. ENaC also mediates aldosterone-dependent sodium re-uptake in the distal nephron of the kidney, thus regulating blood pressure. Gain-of-function mutations in beta- or gamma-ENaC can cause severe arterial hypertension (Liddel's syndrome) and loss-of-function mutations in alpha- or beta-ENaC causes pseudohypoaldosteronism (PHA-1).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-18256
Species: Ha, Hu, Mu, Rt, Xp
Applications: IHC, WB
NBP3-18257
Species: Ha, Hu, Mu, Rt, Xp
Applications: ICC/IF, IHC, IP, WB
NBP1-44270
Species: Ca, Hu, Mu, Rt
Applications: EM, ICC/IF, IHC,  IHC-P, WB
AF3200
Species: Hu
Applications: IHC, WB
NB300-562
Species: Ch, Hu, Mu, Rb, Rt, Sh
Applications: B/N, Flow, ICC/IF, IHC,  IHC-P, WB
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-80993
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB110-74682
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-15303
Species: Hu, Mu
Applications: CHIP-SEQ, ICC/IF, IHC,  IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP1-82574
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, PAGE, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
NB100-40845
Species: Hu, Mu
Applications: ChIP, CHIP-SEQ, IHC,  IHC-P, IP, KD, WB
NBP2-16684
Species: Hu, Mu, Rt
Applications: EM, IHC,  IHC-P, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for epithelial Sodium Channel alpha Protein (NBP1-84846PEP) (0)

There are no publications for epithelial Sodium Channel alpha Protein (NBP1-84846PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for epithelial Sodium Channel alpha Protein (NBP1-84846PEP) (0)

There are no reviews for epithelial Sodium Channel alpha Protein (NBP1-84846PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for epithelial Sodium Channel alpha Protein (NBP1-84846PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional epithelial Sodium Channel alpha Products

Research Areas for epithelial Sodium Channel alpha Protein (NBP1-84846PEP)

Find related products by research area.

Blogs on epithelial Sodium Channel alpha

There are no specific blogs for epithelial Sodium Channel alpha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our epithelial Sodium Channel alpha Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SCNN1A