Ephrin-A5 Recombinant Protein Antigen

Images

 
There are currently no images for Ephrin-A5 Recombinant Protein Antigen (NBP2-58251PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Ephrin-A5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Ephrin-A5.

Source: E.coli

Amino Acid Sequence: FYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGENAAQ

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
EFNA5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-58251 The protein was purified by IMAC chromatography and the expected concentration is greater than 0.5 mg/ml. This protein is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Ephrin-A5 Recombinant Protein Antigen

  • AF1
  • AL-1
  • EFL-5
  • EFNA5
  • EPH-related receptor tyrosine kinase ligand 7
  • EphrinA5
  • Ephrin-A5
  • EPLG7
  • GLC1M
  • LERK-7
  • LERK7EFL5
  • RAGS

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

8415-A2
Species: Mu
NB300-731
Species: Hu, Mu, Rt, Gp, Rb, Sh, Ye
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, B/N
AF3034
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
359-EA
Species: Hu
MAB541
Species: Hu, Rt
Applications: WB, Flow, CyTOF-ready, ICC
NB100-56603
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
640-A3
Species: Mu
AF641
Species: Mu
Applications: WB, IHC
NB200-310
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, IP
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-38530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005241-M08
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-58251PEP
Species: Hu
Applications: AC

Publications for Ephrin-A5 Recombinant Protein Antigen (NBP2-58251PEP) (0)

There are no publications for Ephrin-A5 Recombinant Protein Antigen (NBP2-58251PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ephrin-A5 Recombinant Protein Antigen (NBP2-58251PEP) (0)

There are no reviews for Ephrin-A5 Recombinant Protein Antigen (NBP2-58251PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Ephrin-A5 Recombinant Protein Antigen (NBP2-58251PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional Ephrin-A5 Products

Bioinformatics Tool for Ephrin-A5 Recombinant Protein Antigen (NBP2-58251PEP)

Discover related pathways, diseases and genes to Ephrin-A5 Recombinant Protein Antigen (NBP2-58251PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ephrin-A5 Recombinant Protein Antigen (NBP2-58251PEP)

Discover more about diseases related to Ephrin-A5 Recombinant Protein Antigen (NBP2-58251PEP).
 

Pathways for Ephrin-A5 Recombinant Protein Antigen (NBP2-58251PEP)

View related products by pathway.

PTMs for Ephrin-A5 Recombinant Protein Antigen (NBP2-58251PEP)

Learn more about PTMs related to Ephrin-A5 Recombinant Protein Antigen (NBP2-58251PEP).
 

Research Areas for Ephrin-A5 Recombinant Protein Antigen (NBP2-58251PEP)

Find related products by research area.

Blogs on Ephrin-A5

There are no specific blogs for Ephrin-A5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Ephrin-A5
374-EA-200

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Ephrin-A5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol EFNA5