EPCR Antibody

Images

 
Immunohistochemistry: EPCR Antibody [NBP1-88168] - Staining of human lung shows distinct positivity in endothelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EPCR Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LQRLHMLQISYFRDPYHVWYQGNASLGGHLTHVLEGPDTNTTIIQLQPLQEPESWARTQSGLQSYLLQFHGLVRLVHQERTLAFPLTIR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PROCR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
EPCR Protein (NBP1-88168PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EPCR Antibody

  • APC receptor
  • CCCA
  • CCD41
  • CCD41centrosome-associated protein
  • CD201 antigen
  • CD201
  • centrocyclin
  • Endothelial cell protein C receptor
  • endothelial protein C receptor
  • EPCR
  • EPCRMGC23024
  • PROCR
  • protein C receptor, endothelial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-07799
Species: Hu
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF4885
Species: Mu
Applications: WB, IP
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-42213
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-78028
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, ICC/IF
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-88114
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-49382
Species: Hu
Applications: IHC
NBP1-33320
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for EPCR Antibody (NBP1-88168) (0)

There are no publications for EPCR Antibody (NBP1-88168).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EPCR Antibody (NBP1-88168) (0)

There are no reviews for EPCR Antibody (NBP1-88168). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for EPCR Antibody (NBP1-88168) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EPCR Products

Bioinformatics Tool for EPCR Antibody (NBP1-88168)

Discover related pathways, diseases and genes to EPCR Antibody (NBP1-88168). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EPCR Antibody (NBP1-88168)

Discover more about diseases related to EPCR Antibody (NBP1-88168).
 

Pathways for EPCR Antibody (NBP1-88168)

View related products by pathway.

PTMs for EPCR Antibody (NBP1-88168)

Learn more about PTMs related to EPCR Antibody (NBP1-88168).

Blogs on EPCR

There are no specific blogs for EPCR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EPCR Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PROCR
Entrez