EPB42 Antibody

Images

 
Immunohistochemistry-Paraffin: EPB42 Antibody [NBP1-82762] - Staining of human gallbladder shows positivity in erythrocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EPB42 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FAQEDIAICRPHLAIKMPEKAEQYQPLTASVSLQNSLDAPMEDCVISILGRGLIHRERSYRFRSVWPENTMCAKFQFTPTHVGLQRLTVEVDCNMFQNLTNYKSVT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EPB42
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
EPB42 Protein (NBP1-82762PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EPB42 Antibody

  • E42P
  • erythrocyte membrane protein band 4.2
  • Erythrocyte protein 4.2
  • erythrocyte surface protein band 4.2
  • MGC116735
  • MGC116737
  • P4.2
  • PA
  • SPH5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-930
Species: Hu, Ba
Applications: WB, ELISA
AF1310
Species: Hu
Applications: WB, IHC, IP
NBP2-20648
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-80633
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-79833
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-89228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
MAB8550
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC, KO
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-14868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-05027
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, PEP-ELISA, S-ELISA
NBP1-84168
Species: Hu
Applications: IHC, IHC-P

Publications for EPB42 Antibody (NBP1-82762) (0)

There are no publications for EPB42 Antibody (NBP1-82762).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EPB42 Antibody (NBP1-82762) (0)

There are no reviews for EPB42 Antibody (NBP1-82762). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for EPB42 Antibody (NBP1-82762) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EPB42 Products

Bioinformatics Tool for EPB42 Antibody (NBP1-82762)

Discover related pathways, diseases and genes to EPB42 Antibody (NBP1-82762). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EPB42 Antibody (NBP1-82762)

Discover more about diseases related to EPB42 Antibody (NBP1-82762).
 

Pathways for EPB42 Antibody (NBP1-82762)

View related products by pathway.

PTMs for EPB42 Antibody (NBP1-82762)

Learn more about PTMs related to EPB42 Antibody (NBP1-82762).

Blogs on EPB42

There are no specific blogs for EPB42, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EPB42 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EPB42