Recombinant Human EPB41L1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human EPB41L1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-88 of Human EPB41L1

Source: Wheat Germ

Amino Acid Sequence: MEEKDYSEADGLSERTTPSKAQKSPQKIAKKYKSAICRVTLLDASEYECEVEKHGRGQVLFDLVCEHLNLLEKDYFGLTFCDADSQKN

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
EPB41L1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
35.42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human EPB41L1 Protein

  • band 4.1-like protein 1
  • DKFZp686H17242
  • erythrocyte membrane protein band 4.1-like 1
  • KIAA0338Neuronal protein 4.1,4.1N
  • MGC11072
  • neuron-type nonerythroid protein 4.1

Background

EPB41L1 - erythrocyte membrane protein band 4.1-like 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00002035-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB110-61027
Species: Hu, Mu, Rt, Pm, Xp
Applications: WB, Simple Western
NBP1-90325
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84597
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-16396
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-66296
Species: Hu
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-21398
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
H00004354-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NB110-75039
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87757
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB7745
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-83227
Species: Hu, Mu(-)
Applications: WB, IHC, IHC-P
H00005034-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-87801
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00002036-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for EPB41L1 Partial Recombinant Protein (H00002036-Q01) (0)

There are no publications for EPB41L1 Partial Recombinant Protein (H00002036-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EPB41L1 Partial Recombinant Protein (H00002036-Q01) (0)

There are no reviews for EPB41L1 Partial Recombinant Protein (H00002036-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EPB41L1 Partial Recombinant Protein (H00002036-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for EPB41L1 Partial Recombinant Protein (H00002036-Q01)

Discover related pathways, diseases and genes to EPB41L1 Partial Recombinant Protein (H00002036-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EPB41L1 Partial Recombinant Protein (H00002036-Q01)

Discover more about diseases related to EPB41L1 Partial Recombinant Protein (H00002036-Q01).
 

Pathways for EPB41L1 Partial Recombinant Protein (H00002036-Q01)

View related products by pathway.

PTMs for EPB41L1 Partial Recombinant Protein (H00002036-Q01)

Learn more about PTMs related to EPB41L1 Partial Recombinant Protein (H00002036-Q01).

Blogs on EPB41L1

There are no specific blogs for EPB41L1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

c-Fos Antibody
NB110-75039
EPB41L1 Antibody
NBP2-31572

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human EPB41L1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol EPB41L1