EOMES Antibody - BSA Free

Immunohistochemistry-Paraffin: EOMES Antibody [NBP1-80699] - Staining of human lymph node tissues shows moderate nuclear positivity in non-germinal center cells.

Immunohistochemistry-Paraffin: EOMES Antibody [NBP1-80699] - Staining of human cerebral cortex shows moderate nuclear positivity in neurons.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

EOMES Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KGFRDNYDSMYTASENDRLTPSPTDSPRSHQIVPGGRYGVQSFFPEPFVNTLPQARYYNGERTVPQTNGLLSPQQSEEVANPPQRWLVTPVQQPGTNKLDISSYESEYTSSTLLPYGIKSLPLQTSHALGYYPDPTFPAMAGWGGRGSYQRKMAAGLPWTSRTSPTV
• Predicted Species: Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EOMES
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Frozen Reported in scientific literature (PMID: 28790368)
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  EOMES Protein (NBP1-80699PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for EOMES Antibody - BSA Free

• EOMES
• eomesodermin (Xenopus laevis) homolog
• Eomesodermin
• t box, brain, 2
• T-box brain protein 2
• T-box brain2
• TBR2
• TBR-2
• TBR2eomesodermin homolog
• T-brain-2

Background

EOMES encodes a member of a conserved protein family that shares a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. A similiar gene disrupted in mice is shown to be essential during trophoblast development and gastrulation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for EOMES Antibody (NBP1-80699)(4)

Publications using NBP1-80699

• Montoya T, SAnchez-Hidalgo M, CastejOn ML et al. Oleocanthal Supplemented Diet Improves Renal Damage And Endothelial Dysfunction In Pristane-Induced Systemic Lupus Erythematosus In Mice Food Research International 2022-11-01 [PMID: 36596095] (Mouse)
• Mi Y, Wei C, Sun L et al. Melatonin inhibits ferroptosis and delays age-related cataract by regulating SIRT6/p-Nrf2/GPX4 and SIRT6/NCOA4/FTH1 pathways Biomedicine & Pharmacotherapy 2023-01-01 [PMID: 36463827] (WB, Rat)
• Sahmatova L, Sugis E, Sunina M et al. Signs of innate immune activation and premature immunosenescence in psoriasis patients Sci Rep 2017-08-08 [PMID: 28790368] (IHC-F, Human)
• Mosenson JA, Zloza A, NielJD et al. Mutant HSP70 Reverses Autoimmune Depigmentation in Vitiligo. Sci Transl Med 2013-02-27 [PMID: 23447019]

Review for EOMES Antibody (NBP1-80699) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Rhesus monkey.

reviewed by: Verified Customer IHC-P Rhesus monkey 06/14/2017

Summary

• Application: Immunohistochemistry-Paraffin
• Sample Tested: Adult kidney
• Species: Rhesus monkey
• Lot: A104960

Comments

• Comments: Paraffin sections after antigen retrieval pH9, and permeabilization with triton 0.3%. AF488 was used as secondary.

FAQs for EOMES Antibody (NBP1-80699). (Showing 1 - 1 of 1 FAQs).

1. Please supply a list of eomes antibodies
   • Here is a link to all of our EOMES antibodies

Bioinformatics

• Gene Symbol: EOMES
• Entrez:
  • 8320(Human)
• Uniprot:
  • O95936(Human)