ENT2 Antibody

Images

 
Western Blot: ENT2 Antibody [NBP1-85253] - Analysis in control (vector only transfected HEK293T lysate) and SLC29A2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: ENT2 Antibody [NBP1-85253] - Staining of human hippocampus shows strong nuclear positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ENT2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KFARYYLANKSSQAQAQELETKAELLQSDENGIPSSPQKVALTLDLDLEKEPESEPDEPQKPGKPSVFTVFQK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC29A2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ENT2 Protein (NBP1-85253PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ENT2 Antibody

  • Delayed-early response protein 12
  • DER12Solute carrier family 29 member 2
  • ENT2
  • Equilibrative NBMPR-insensitive nucleoside transporter
  • Equilibrative nitrobenzylmercaptopurine riboside-insensitive nucleosidetransporter
  • equilibrative nucleoside transporter 2
  • HNP3636 kDa nucleolar protein HNP36
  • Hydrophobic nucleolar protein, 36 kDa
  • hydrophobic nucleolar protein, 36kD
  • Nucleoside transporter, ei-type
  • solute carrier family 29 (nucleoside transporters), member 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32222
Species: Hu
Applications: WB, IHC-P, IP
NBP2-33451
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-30857
Species: Hu
Applications: IHC, IHC-P
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84418
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20813
Species: Hu, Mu
Applications: WB, ICC/IF
NB100-368
Species: Hu
Applications: WB
NBP2-31589
Species: Hu
Applications: WB, IHC, IHC-P
MAB6240
Species: Hu
Applications: WB, IHC
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-41314
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
AF1235
Species: Hu
Applications: WB, IHC
NBP2-43639
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00006583-A01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-FrFl, IHC-WhMt
NBP2-19417
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15291
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31368
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85253
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ENT2 Antibody (NBP1-85253) (0)

There are no publications for ENT2 Antibody (NBP1-85253).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ENT2 Antibody (NBP1-85253) (0)

There are no reviews for ENT2 Antibody (NBP1-85253). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ENT2 Antibody (NBP1-85253) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ENT2 Products

Bioinformatics Tool for ENT2 Antibody (NBP1-85253)

Discover related pathways, diseases and genes to ENT2 Antibody (NBP1-85253). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ENT2 Antibody (NBP1-85253)

Discover more about diseases related to ENT2 Antibody (NBP1-85253).
 

Pathways for ENT2 Antibody (NBP1-85253)

View related products by pathway.

PTMs for ENT2 Antibody (NBP1-85253)

Learn more about PTMs related to ENT2 Antibody (NBP1-85253).

Blogs on ENT2

There are no specific blogs for ENT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ENT2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC29A2