ENPP-3/CD203c Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

ENPP-3/CD203c Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ENPP3.
  
  

  Source: E. coli

  Amino Acid Sequence: LHYAKNVRIDKVHLFVDQQWLAVRSKSNTNCGGGNHGYNNEFRSMEAIFLAHGPSFKEKTEVEPFEN

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: ENPP3
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88928.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 25 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ENPP-3/CD203c Recombinant Protein Antigen

• B10
• CD203c antigen
• CD203c
• dJ1005H11.3 (phosphodiesterase I/nucleotide pyrophosphatase 3)
• dJ914N13.3 (phosphodiesterase I/nucleotide pyrophosphatase 3)
• ectonucleotide pyrophosphatase/phosphodiesterase 3
• ectonucleotide pyrophosphatase/phosphodiesterase family member 3
• E-NPP 3
• ENPP3
• ENPP-3
• gp130RB13-6
• NPP3
• PD-IBETA
• PDNP3
• PDNP3B10
• Phosphodiesterase I beta
• Phosphodiesterase I/nucleotide pyrophosphatase 3
• phosphodiesterase-I beta

Background

The ENPP3 gene encodes a 875 amino acid long, 100 kDA ectonucleotide pyrophosphatase/phosphodiesterase family member 3 protein that separates multiple phosphodiester and phosphosulfate bonds, specifically in deoxynucleotides, nucleotide sugars, and NAD. ENPP3 participates in NAD metabolism, purine metabolism, riboflavin metabolism, and pantothenate and CoA biosynthesis. ENPP3 has been linked to carcinoma, bile duct cancer, urticaria, retinitis, epididymitis, prostatitis, urticaria, and asthma as it interacts with genes GRB2, CD38, NADK, BST1, and ACPP.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: ENPP3