engrailed homeobox 2 Antibody - BSA Free

Immunohistochemistry-Paraffin: engrailed homeobox 2 Antibody [NBP3-10900] - Immunohistochemical analysis of paraffin-embedded human kidney tissue.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

engrailed homeobox 2 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human engrailed homeobox 2 (NP_001418). Peptide sequence NESQIKIWFQNKRAKIKKATGNKNTLAVHLMAQGLYNHSTTAKEGKSDSE
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EN2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
• Theoretical MW: 34 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for engrailed homeobox 2 Antibody - BSA Free

• AUTS10
• EN2
• engrailed homeobox 2
• engrailed homolog 2
• Engrailed2
• Engrailed-2
• Homeobox protein en-2
• homeobox protein engrailed-2
• hu-En-2

Background

EN1 and EN2 encode homeodomain containing proteins and have been implicated in the control of pattern formation during development of the central nervous system. EN2 may play a role in susceptibility to autism spectrum disorders.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EN2