Endophilin B1/Bif-1 Recombinant Protein Antigen

Images

 
There are currently no images for Endophilin B1/Bif-1 Protein (NBP1-89972PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Endophilin B1/Bif-1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SH3GLB1.

Source: E.coli

Amino Acid Sequence: DRKAPSRINNPELLGQYMIDAGTEFGPGTAYGNALIKCGETQKRIGTADRELIQTSALNFLTPLRNFIEGDYKTIAKER

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SH3GLB1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-89972.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Endophilin B1/Bif-1 Recombinant Protein Antigen

  • Bax-interacting factor 1
  • Bif1
  • Bif-1
  • Bif-1dJ612B15.2
  • CGI-61
  • Endophilin B1
  • endophilin-B1
  • KIAA0491endophilin B1
  • SH3 domain-containing GRB2-like protein B1
  • SH3-containing protein SH3GLB1
  • SH3-domain GRB2-like endophilin B1
  • SH3-domain, GRB2-like, endophilin B1
  • SH3GLB1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP2-24482
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB
NB500-249
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NB100-2331
Species: Hu, Mu, Rt, Ca, Fi, Pl, Ze
Applications: WB, Simple Western, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, SB
NB110-55288
Species: Hu, Mu, Rt, Fi, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NB110-53818
Species: Hu, Mu, Rt, Po, Bv, Pm, Xp, Ze
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NB100-56092
Species: Hu
Applications: WB, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB110-87320
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ICC/IF
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-14835
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF1747
Species: Hu
Applications: WB, IP, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-89972PEP
Species: Hu
Applications: AC

Publications for Endophilin B1/Bif-1 Protein (NBP1-89972PEP) (0)

There are no publications for Endophilin B1/Bif-1 Protein (NBP1-89972PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Endophilin B1/Bif-1 Protein (NBP1-89972PEP) (0)

There are no reviews for Endophilin B1/Bif-1 Protein (NBP1-89972PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for Endophilin B1/Bif-1 Protein (NBP1-89972PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Endophilin B1/Bif-1 Products

Bioinformatics Tool for Endophilin B1/Bif-1 Protein (NBP1-89972PEP)

Discover related pathways, diseases and genes to Endophilin B1/Bif-1 Protein (NBP1-89972PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Endophilin B1/Bif-1 Protein (NBP1-89972PEP)

Discover more about diseases related to Endophilin B1/Bif-1 Protein (NBP1-89972PEP).
 

Pathways for Endophilin B1/Bif-1 Protein (NBP1-89972PEP)

View related products by pathway.

PTMs for Endophilin B1/Bif-1 Protein (NBP1-89972PEP)

Learn more about PTMs related to Endophilin B1/Bif-1 Protein (NBP1-89972PEP).
 

Research Areas for Endophilin B1/Bif-1 Protein (NBP1-89972PEP)

Find related products by research area.

Blogs on Endophilin B1/Bif-1

There are no specific blogs for Endophilin B1/Bif-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

LC3A Antibody
NB100-2331

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Endophilin B1/Bif-1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SH3GLB1
Entrez