Home » ENDOGL1 » ENDOGL1 Proteins » ENDOGL1 Recombinant Protein Antigen

ENDOGL1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for ENDOGL1 Recombinant Protein Antigen (NBP2-62597PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

ENDOGL1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ENDOGL1

Source: E.coli

Amino Acid Sequence: VIGEDNVAVPSHLYKVILARRSSVSTEPLALGAFVVPNEAIGFQPQLTEFQVSLQDLEKLSGLVFFPHLDRTSDIRNICSVDTCKLLDFQEFTLYLSTRKIEGARSVLRLEKIMENLKNAEIEPDDYFMSRYEKKLEELKAKEQSGTQIR
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
EXOG
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-62597. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related protocol, click here.
Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for ENDOGL1 Recombinant Protein Antigen

  • EC 3.1.30
  • EC 3.1.30.-
  • Endo G-like 1
  • endo/exonuclease (5'-3'), endonuclease G-like
  • ENDOGL1mitochondrial
  • ENDOGL2
  • Endonuclease G-like 1MGC125945
  • ENGLA
  • ENGLB
  • ENGLMGC125944

Background

The ENDOGL1 gene encodes an endo/exonuclease with 5'-3' exonuclease activity. The encoded enzyme catalyzes the hydrolysis of ester linkages at the 5' end of a nucleic acid chain. This enzyme is localized to the mitochondria and may play a role in programmed cell

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western blot shows lysates of HEK293T human embryonic kidney cell line untreated (-) or treated (+) with 20 mJ/cm2 ultraviolet light (UV) with a 30 minute recovery. PVDF membrane was probed with 0.5 μg/mL of Rabbit Anti-Human Phospho-c‑Jun (S63) Monoclonal Antibody (Catalog # MAB8930) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-c‑Jun (S63) at approximately 45 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
c‑Junphosphorylated at S63 was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line treated with Anisomycin using Rabbit Anti-HumanPhospho-c‑Jun (S63) Monoclonal Antibody (Catalog # MAB8930) at 1 μg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Simple Western lane view shows lysates of HEK293T human embryonic kidney cell line untreated (-) or treated (+) with 20 mJ/cm2 ultraviolet light (UV) with a 30 minute recovery, loaded at 0.2 mg/mL. A specific band was detected for Phospho-c‑Jun (S63) at approximately 49 kDa (as indicated) using 5 μg/mL of Rabbit Anti-Human Phospho-c‑Jun (S63) Monoclonal Antibody (Catalog # MAB8930) . This experiment was conducted under reducing conditions and using the 12-230 kDa separation system. Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody.
(1 Review)
(2 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
IRF1 Antibody
(SR44-08)
NBP2-67330
Flow Cytometry: IRF1 Antibody (SR44-08) [NBP2-67330] - Analysis of Jurkat cells with IRF1 antibody at 1/50 dilution (blue) compared with an unlabelled control (cells without incubation with primary antibody; red). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: IRF1 Antibody (SR44-08) [NBP2-67330] - Staining IRF1 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: IRF1 Antibody (SR44-08) [NBP2-67330] - Staining IRF1 in NIH/3T3 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Neprilysin-2/MMEL1
Antibody
AF2340
Neprilysin-2/MMEL1 Antibody
(1 Review)
Species: Hu
Applications: CyTOF-ready, Flow, IP, WB
Plexin B1 Antibody
[Unconjugated]
AF3749
Plexin B1 Antibody [Unconjugated]
(3 Publications)
Species: Hu
Applications: IHC, WB
Integrin alpha
2/CD49b Antibody (HAS ...
MAB1233
Integrin  alpha 2/CD49b was detected in immersion fixed HT1080 human fibrosarcoma cell line using Mouse Anti-Human Integrin  alpha 2/CD49b Monoclonal Antibody (Catalog # MAB1233) at 25 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to plasma membranes and cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
HT1080 human fibrosarcoma cell line was stained with Mouse Anti-Human Integrin  alpha 2/CD49b Monoclonal Antibody (Catalog # MAB1233, filled histogram) or isotype control antibody (Catalog # MAB003, open histogram), followed by Phycoerythrin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0102B). View our protocol for Staining Membrane-associated Proteins.
(6 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IP
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Insulin was detected in immersion fixed beta TC‑6 mouse beta cell insulinoma cell line using Human/Mouse/Bovine Insulin Monoclonal Antibody (Catalog # MAB1417) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red; Catalog # NL013) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(16 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
BRD2 Antibody
NBP1-30475
Immunohistochemistry-Paraffin: BRD2 Antibody [NBP1-30475] - Section of human ovarian carcinoma. Antibody: Affinity purified rabbit anti-BRD2 (NBP1-30475). Detection: DAB
Immunocytochemistry/Immunofluorescence: BRD2 Antibody [NBP1-30475] - Formaldehyde-fixed asynchronous HeLa cells. Antibody: Affinity purified rabbit anti- BRD2 used at a dilution of 1:100 (2 ug/mL) (left) and rabbit anti-BRD2 recombinant monoclonal used at a dilution of 1:20 (right). Detection: Red-fluorescent goat anti-rabbit IgG cross-adsorbed Antibody DyLight 594 conjugated.
Immunoprecipitation: BRD2 Antibody [NBP1-30475] - Detection of human BRD2 by western blot of immunoprecipitates. Samples: Whole cell lysate (1.0 mg per IP reaction; 20% of IP loaded) from HEK293T cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-BRD2 antibody NBP1-30475 used for IP at 6 ug per reaction. BRD2 was also immunoprecipitated by rabbit anti-BRD2 antibody NBP1-30474 and rabbit anti-BRD2 recombinant monoclonal antibody [BL-167-2A2] (NBP2-76410). For blotting immunoprecipitated BRD2, NBP2-76410 was used at 1:1000. Detection: Chemiluminescence with an exposure time time of 3 minutes.
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
ZBTB8OS Antibody
NBP2-30455
Immunohistochemistry: ZBTB8OS Antibody [NBP2-30455] - Staining of human spleen shows strong cytoplasmic positivity in cells in white pulp.
Immunocytochemistry/Immunofluorescence: ZBTB8OS Antibody [NBP2-30455] - Staining of human cell line A-431 shows localization to plasma membrane.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Endo G Antibody -
BSA Free
NBP1-76657
Immunofluorescence: Endo G Antibody [NBP1-76657] - Human pancreas tissue with EndoG antibody at 20 ug/mL. Green: EndoG Antibody Blue: DAPI staining
Immunohistochemistry: Endo G Antibody [NBP1-76657] - Analysis of human pancreas tissue with EndoG antibody at 2.5 ug/ml.
Western Blot: Endo G Antibody [NBP1-76657] - Western Blot Validation in Mouse 3T3 (M) and Human HepG2 (H) cell lysates. Loading: 15 ug of lysates per lane. Antibodies: Endo G NBP1-76657 (2 ug/ml), 1h incubation at RT in 5% NFDM/TBST. Secondary: Goat anti-rabbit IgG HRP conjugate at 1:10000 dilution.
(2 Publications)
Species: Ca, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IF, IHC, IHC-P, WB
Muscleblind-like 1
Antibody (3E7)
H00004154-M02
Western Blot: Muscleblind-like 1 Antibody (3E7) [H00004154-M02] - MBNL1 monoclonal antibody (M02), clone 3E7 Analysis of MBNL1 expression in Hela S3 NE.
ELISA: Muscleblind-like 1 Antibody (3E7) [H00004154-M02] - Muscleblind-like 1 Antibody (3E7) [H00004154-M02] - Detection limit for recombinant GST tagged MBNL1 is approximately 3ng/ml as a capture antibody.
Immunocytochemistry/Immunofluorescence: Muscleblind-like 1 Antibody (3E7) [H00004154-M02] - Analysis of monoclonal antibody to MBNL1 on HeLa cell. Antibody concentration 10 ug/ml.
(2 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Actin Antibody
(mAbGEa)
NB100-74340
Immunocytochemistry/Immunofluorescence: Actin Antibody (mAbGEa) [NB100-74340] - NIH-3T3 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton X-100. The cells were incubated with anti-Actin (mAbGEa) at 5 ug/mL overnight at 4C and detected with an anti-Mouse IgM DyLight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Western Blot: Actin Antibody (mAbGEa) [NB100-74340] - Total protein from HeLa, 3T3, PC12 and Bovine normal tissue was separated on a 12% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/mL anti-Actin in 5% blocking buffer and detected with an anti-mouse IgM secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: Actin Antibody (mAbGEa) [NB100-74340] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-Actin Antibody (mAbGEa) at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
(8 Reviews)
(31 Publications)
Species: Bv, ChHa, Dr, Fu, Hu, Mu, Pl, Pr, Rb, Rt, Sh, Xp, Ye, Ze
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Osteocalcin
Antibody (190125)
MAB1419
Saos‑2 human osteosarcoma cell line was stained with Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
Human osteoblasts were stained with Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
Osteocalcin was detected in human mesenchymal stem cells differentiated into osteocytes using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(3 Reviews)
(32 Publications)
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
GEN1 Antibody
NBP2-30783
Western Blot: GEN1 Antibody [NBP2-30783] - Analysis in human cell line RH-30.
Immunocytochemistry/Immunofluorescence: GEN1 Antibody [NBP2-30783] - Immunofluorescent staining of human cell line RH-30 shows localization to nucleoplasm.
Species: Hu
Applications: ICC/IF, WB
Kallikrein 3/PSA
[HRP]
DKK300
(16 Publications)
Species: Hu
Applications: ELISA
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western lane view shows lysates of human serum, loaded at 1:25000. A specific band was detected for Albumin at approximately 64 kDa (as indicated) using 1 µg/mL of Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) . This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Albumin was detected in immersion fixed BG01V human embryonic stem cells differentiated to hepatocytes using Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. Cells were co-stained using Sheep Anti-Human CEBP alpha (Catalog # AF7094) and NorthernLights™ 493-conjugated Anti-Sheep IgG Secondary Antibody (green, Catalog # NL012). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Albumin was detected in immersion fixed paraffin-embedded sections of human liver using Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) at 0.1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm and plasma membrane. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(3 Reviews)
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NDUFB6 Antibody
NBP1-92172
Immunohistochemistry-Paraffin: NDUFB6 Antibody [NBP1-92172] - Staining of human prostate shows strong cytoplasmic positivity with granular pattern in glandular cells.
Western Blot: NDUFB6 Antibody [NBP1-92172] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/Immunofluorescence: NDUFB6 Antibody [NBP1-92172] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & mitochondria.
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
CD4 Antibody - BSA
Free
NBP1-19371
Immunohistochemistry-Frozen: CD4 Antibody [NBP1-19371] - Staining in mouse liver tissue.
Immunohistochemistry-Paraffin: CD4 Antibody [NBP1-19371] - Alcohol-fixed paraffin-embedded rat spleen tissue. Dilution 1:150. Image from verified customer review.
Flow Cytometry: CD4 Antibody [NBP1-19371] - An intracellular stain was performed on Jurkat cells with CD4 Antibody NBP1-19371R (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 550.
(9 Reviews)
(41 Publications)
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
C-Reactive
Protein/CRP [HRP]
DCRP00
(134 Publications)
Species: Hu
Applications: ELISA
Doublecortin
Antibody
NBP1-72042
Western Blot: Doublecortin Antibody [NBP1-72042] - staining of Mouse fetal Brain lysate (35 ug protein in RIPA buffer). Antibody at 0.01 ug/mL. Primary incubation was 1 hour. Detected by chemiluminescence.
Immunocytochemistry/Immunofluorescence: Doublecortin Antibody [NBP1-72042] - Immunofluorescence analysis of paraformaldehyde fixed HepG2 cells, permeabilized with 0.15% Triton. Primary incubation 1hr (5 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL), showing cytoplasmic staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL).
Immunocytochemistry/Immunofluorescence: Doublecortin Antibody [NBP1-72042] - Immunofluorescence analysis of paraformaldehyde fixed KNRK cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing cytoplasmic staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
ACE/CD143 Antibody
[Unconjugated]
AF1513
ACE/CD143 was detected in perfusion fixed frozen sections of mouse kidney using 15 µg/mL Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) overnight at 4 °C. Tissue was stained (red). View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
Western blot shows lysates of mouse lung tissue. PVDF membrane was probed with 0.05 µg/mL of Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for ACE/CD143 at approximately 180 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of mouse lung tissue, loaded at 0.2 mg/mL. A specific band was detected for ACE/CD143 at approximately 218 kDa (as indicated) using 10 µg/mL of Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 66-440 kDa separation system.
(1 Review)
(4 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB

Publications for ENDOGL1 Recombinant Protein Antigen (NBP2-62597PEP) (0)

There are no publications for ENDOGL1 Recombinant Protein Antigen (NBP2-62597PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ENDOGL1 Recombinant Protein Antigen (NBP2-62597PEP) (0)

There are no reviews for ENDOGL1 Recombinant Protein Antigen (NBP2-62597PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ENDOGL1 Recombinant Protein Antigen (NBP2-62597PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ENDOGL1 Products

Bioinformatics Tool for ENDOGL1 Recombinant Protein Antigen (NBP2-62597PEP)

Discover related pathways, diseases and genes to ENDOGL1 Recombinant Protein Antigen (NBP2-62597PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ENDOGL1 Recombinant Protein Antigen (NBP2-62597PEP)

Discover more about diseases related to ENDOGL1 Recombinant Protein Antigen (NBP2-62597PEP).
 

Pathways for ENDOGL1 Recombinant Protein Antigen (NBP2-62597PEP)

View related products by pathway.

Blogs on ENDOGL1

There are no specific blogs for ENDOGL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Immunohistochemistry-Frozen: CD4 Antibody [NBP1-19371] - Staining in mouse liver tissue.
CD4 Antibody - BSA Free
NBP1-19371

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ENDOGL1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol EXOG