EN1/Engrailed 1 Antibody (3G9) - Azide and BSA Free Summary
Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
Immunogen |
EN1 (NP_001417, 266 a.a. ~ 392 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNEKEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQTLAQELSLNESQIKIWFQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKDESE* |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
EN1 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
It has been used for ELISA and WB. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for EN1/Engrailed 1 Antibody (3G9) - Azide and BSA Free
Background
Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: BA
Species: Hu, Mu
Applications: ICC/IF, PEP-ELISA, WB
Species: Mu
Applications: BA
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, IHC, WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: ICC, ICFlow, Simple Western, WB
Species: Hu
Applications: BA, BA
Species: Hu, Mu, Rt
Applications: BA
Species: Hu, Mu
Applications: Flow, ICC, IHC, mIF, Simple Western, WB
Species: Hu
Applications: WB, ELISA
Publications for EN1/Engrailed 1 Antibody (H00002019-M10) (0)
There are no publications for EN1/Engrailed 1 Antibody (H00002019-M10).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for EN1/Engrailed 1 Antibody (H00002019-M10) (0)
There are no reviews for EN1/Engrailed 1 Antibody (H00002019-M10).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for EN1/Engrailed 1 Antibody (H00002019-M10) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional EN1/Engrailed 1 Products
Research Areas for EN1/Engrailed 1 Antibody (H00002019-M10)
Find related products by research area.
|
Blogs on EN1/Engrailed 1