EN1/Engrailed 1 Antibody (3G9)

Images

 
Western Blot: EN1/Engrailed 1 Antibody (3G9) [H00002019-M10] - Analysis of EN1 expression in Jurkat.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3G9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

EN1/Engrailed 1 Antibody (3G9) Summary

Immunogen
EN1 (NP_001417, 266 a.a. - 392 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNEKEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQTLAQELSLNESQIKIWFQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKDESE*
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
EN1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EN1/Engrailed 1 Antibody (3G9)

  • engrailed homeobox 1
  • engrailed homolog 1
  • Homeobox protein en-1
  • homeobox protein engrailed-1
  • hu-En-1

Background

Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

423-F8/CF
Species: Hu, Mu
H00002020-M03
Species: Hu
Applications: WB, ELISA, ICC/IF
AF1620
Species: Mu
Applications: WB, IHC
H00005076-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF2156
Species: Hu, Mu
Applications: WB, IHC
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
AF1979
Species: Hu
Applications: WB, Simple Western, ICC
NBP1-92274
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NB100-55393
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
3008-WN/CF
Species: Hu
NBP2-41194
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
AF3487
Species: Hu
Applications: WB, IHC, ICC
H00002019-M10
Species: Hu
Applications: WB, ELISA

Publications for EN1/Engrailed 1 Antibody (H00002019-M10) (0)

There are no publications for EN1/Engrailed 1 Antibody (H00002019-M10).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EN1/Engrailed 1 Antibody (H00002019-M10) (0)

There are no reviews for EN1/Engrailed 1 Antibody (H00002019-M10). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EN1/Engrailed 1 Antibody (H00002019-M10) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EN1/Engrailed 1 Products

Bioinformatics Tool for EN1/Engrailed 1 Antibody (H00002019-M10)

Discover related pathways, diseases and genes to EN1/Engrailed 1 Antibody (H00002019-M10). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EN1/Engrailed 1 Antibody (H00002019-M10)

Discover more about diseases related to EN1/Engrailed 1 Antibody (H00002019-M10).
 

Pathways for EN1/Engrailed 1 Antibody (H00002019-M10)

View related products by pathway.

PTMs for EN1/Engrailed 1 Antibody (H00002019-M10)

Learn more about PTMs related to EN1/Engrailed 1 Antibody (H00002019-M10).

Blogs on EN1/Engrailed 1

There are no specific blogs for EN1/Engrailed 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EN1/Engrailed 1 Antibody (3G9) and receive a gift card or discount.

Bioinformatics

Gene Symbol EN1
Uniprot