EN1/Engrailed 1 Antibody (1F5) Summary
Immunogen |
EN1 (NP_001417, 266 a.a. ~ 392 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNEKEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQTLAQELSLNESQIKIWFQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKDESE* |
Specificity |
EN1 (1F5) |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
EN1 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot 1:500
|
Application Notes |
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. It has been used for IHC-P. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
Quality control test: Antibody Reactive Against Recombinant Protein.
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for EN1/Engrailed 1 Antibody (1F5)
Background
Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: BA
Species: Hu, Mu
Applications: ICC/IF, PEP-ELISA, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, IHC, WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Fi, Hu, Pm, Mu, Pm, Rt, Sh
Applications: ICC/IF, IHC, IP, WB
Species: Hu
Applications: BA, BA
Species: Hu, Mu, Rt
Applications: BA
Species: Ha, Hu, Rt
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Publications for EN1/Engrailed 1 Antibody (H00002019-M06) (0)
There are no publications for EN1/Engrailed 1 Antibody (H00002019-M06).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for EN1/Engrailed 1 Antibody (H00002019-M06) (0)
There are no reviews for EN1/Engrailed 1 Antibody (H00002019-M06).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for EN1/Engrailed 1 Antibody (H00002019-M06) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional EN1/Engrailed 1 Products
Bioinformatics Tool for EN1/Engrailed 1 Antibody (H00002019-M06)
Discover related pathways, diseases and genes to EN1/Engrailed 1 Antibody (H00002019-M06). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for EN1/Engrailed 1 Antibody (H00002019-M06)
Discover more about diseases related to EN1/Engrailed 1 Antibody (H00002019-M06).
| | Pathways for EN1/Engrailed 1 Antibody (H00002019-M06)
View related products by pathway.
|
PTMs for EN1/Engrailed 1 Antibody (H00002019-M06)
Learn more about PTMs related to EN1/Engrailed 1 Antibody (H00002019-M06).
| | Research Areas for EN1/Engrailed 1 Antibody (H00002019-M06)
Find related products by research area.
|
Blogs on EN1/Engrailed 1