EN-RAGE/S100A12 Antibody - BSA Free

Immunohistochemistry-Paraffin: EN-RAGE/S100A12 Antibody [NBP1-86694] - Analysis in human bone marrow and testis tissues using NBP1-86694 antibody. Corresponding S100A12 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: EN-RAGE/S100A12 Antibody [NBP1-86694] - Staining of human bone marrow shows strong cytoplasmic and nuclear positivity in hematopoietic cells.

Immunohistochemistry-Paraffin: EN-RAGE/S100A12 Antibody [NBP1-86694] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.

Immunohistochemistry-Paraffin: EN-RAGE/S100A12 Antibody [NBP1-86694] - Staining of human cerebral cortex shows no positivity in neurons as expected.

Immunohistochemistry-Paraffin: EN-RAGE/S100A12 Antibody [NBP1-86694] - Staining of human skin shows no positivity in squamous epithelial cells as expected.

Analysis in human spleen tissue.

• Reactivity: Hu
• Applications: WB, Simple Western, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

EN-RAGE/S100A12 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit EN-RAGE/S100A12 Antibody - BSA Free (NBP1-86694) is a polyclonal antibody validated for use in IHC, WB and Simple Western. Anti-EN-RAGE/S100A12 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: S100A12
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Simple Western 1:250
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
  See Simple Western Antibody Database for Simple Western validation: Tested in Tissue lysates, antibody dilution of 1:250
• Control Peptide:

  EN-RAGE/S100A12 Protein (NBP1-86694PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for EN-RAGE/S100A12 Antibody - BSA Free

• CAAF1
• CAAF1Neutrophil S100 protein
• CAAFI
• CAGC
• CAGCS100 calcium binding protein A12 (calgranulin C)
• CAGCS100
• Calcium-binding protein in amniotic fluid 1
• Calgranulin C
• calgranulin-C
• CGRPEN-RAGE
• ENRAGE
• EN-RAGE
• Extracellular newly identified RAGE-binding protein
• MRP6
• p6calgranulin C
• protein S100-A12
• S100 calcium binding protein A12
• S100 calcium-binding protein A12 (calgranulin C)
• S100 calcium-binding protein A12
• S100A12

Background

S100A12 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100A12 is proposed to be involved in specific calcium-dependent signal transduction pathways and its regulatory effect on cytoskeletal components may modulate various neutrophil activities. S100A12 is also a ligand for RAGE. Interaction with RAGE on mononuclear phagocytes, lymphocytes and endothelium triggers cellular activation. Nuclear factor kappa B--a key transcription factor for inflammatory events--is activated by S100A12/RAGE. S100A12 has also been shown to have anti-microbial properties.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for EN-RAGE/S100A12 Antibody (NBP1-86694)(1)

Publication using NBP1-86694

• Fuchs C, Stalnaker KJ, Dalgard CL et al. Plantar Skin Exhibits Altered Physiology, Constitutive Activation of Wound-Associated Phenotypes, and Inherently Delayed Healing. The Journal of investigative dermatology 2024-06-22 [PMID: 38237729]

Bioinformatics

• Gene Symbol: S100A12