EN-RAGE/S100A12 Antibody

Images

 
Western Blot: EN-RAGE/S100A12 Antibody [NBP1-86694] - Analysis in human spleen tissue.
Immunocytochemistry/ Immunofluorescence: EN-RAGE/S100A12 Antibody [NBP1-86694] - Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
Immunohistochemistry-Paraffin: EN-RAGE/S100A12 Antibody [NBP1-86694] - Staining of human bone marrow shows strong nuclear positivity in bone marrow poietic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EN-RAGE/S100A12 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
S100A12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
EN-RAGE/S100A12 Protein (NBP1-86694PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EN-RAGE/S100A12 Antibody

  • CAAF1
  • CAAF1Neutrophil S100 protein
  • CAAFI
  • CAGC
  • CAGCS100 calcium binding protein A12 (calgranulin C)
  • CAGCS100
  • Calcium-binding protein in amniotic fluid 1
  • Calgranulin C
  • calgranulin-C
  • CGRPEN-RAGE
  • ENRAGE
  • EN-RAGE
  • Extracellular newly identified RAGE-binding protein
  • MRP6
  • p6calgranulin C
  • protein S100-A12
  • S100 calcium binding protein A12
  • S100 calcium-binding protein A12 (calgranulin C)
  • S100 calcium-binding protein A12
  • S100A12

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4375
Species: Hu, Mu, Rt
Applications: IHC
MAB4077
Species: Hu
Applications: WB, IHC
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB120-14817
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NLS6731
Species: Hu, Rt, Po, Bv, Ca, Eq, Gt, Ha, Mk, Pm, Rb, Xp
Applications: IHC-P
AF6108
Species: Hu
Applications: IHC
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
AF6428
Species: Hu
Applications: WB, IHC
NB600-713
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1617
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-33582
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
AF3059
Species: Mu
Applications: WB, Simple Western, ICC
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-35641
Species: Hu
Applications: WB, IHC, IHC-P

Publications for EN-RAGE/S100A12 Antibody (NBP1-86694) (0)

There are no publications for EN-RAGE/S100A12 Antibody (NBP1-86694).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EN-RAGE/S100A12 Antibody (NBP1-86694) (0)

There are no reviews for EN-RAGE/S100A12 Antibody (NBP1-86694). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for EN-RAGE/S100A12 Antibody (NBP1-86694) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EN-RAGE/S100A12 Products

Bioinformatics Tool for EN-RAGE/S100A12 Antibody (NBP1-86694)

Discover related pathways, diseases and genes to EN-RAGE/S100A12 Antibody (NBP1-86694). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EN-RAGE/S100A12 Antibody (NBP1-86694)

Discover more about diseases related to EN-RAGE/S100A12 Antibody (NBP1-86694).
 

Pathways for EN-RAGE/S100A12 Antibody (NBP1-86694)

View related products by pathway.

PTMs for EN-RAGE/S100A12 Antibody (NBP1-86694)

Learn more about PTMs related to EN-RAGE/S100A12 Antibody (NBP1-86694).
 

Research Areas for EN-RAGE/S100A12 Antibody (NBP1-86694)

Find related products by research area.

Blogs on EN-RAGE/S100A12

There are no specific blogs for EN-RAGE/S100A12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EN-RAGE/S100A12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol S100A12
Entrez