EMX2 Antibody

Immunohistochemistry-Paraffin: EMX2 Antibody [NBP2-39052] - Staining in human epididymis and pancreas tissues using anti-EMX2 antibody. Corresponding EMX2 RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: EMX2 Antibody [NBP2-39052] - Staining of human cell line RH-30 shows localization to nucleus. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: EMX2 Antibody [NBP2-39052] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: EMX2 Antibody [NBP2-39052] - Staining of human epididymis shows high expression.

Product Discontinued

EMX2 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RGVYSNPDLVFAEAVSHPPNPAVPVHPVPPPHALAAHPLPSSHSPHPLFASQQRDPSTFYPWLIHRYRY
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EMX2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for EMX2 Antibody

• empty spiracles homeobox 2
• empty spiracles homolog 2 (Drosophila)
• Empty spiracles homolog 2
• Empty spiracles-like protein 2
• EMX2
• homeobox protein EMX2

Background

The homeodomain transcription factor EMX2 is critical for central nervous system and urogenital development. EMX1 (MIM 600034) and EMX2 are related to the 'empty spiracles' gene expressed in the developing Drosophila head.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EMX2
• Uniprot:
  • Q04743(Human)