Emx1 Antibody

Images

 
Immunohistochemistry-Paraffin: Emx1 Antibody [NBP1-86500] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.
Immunohistochemistry-Paraffin: Emx1 Antibody [NBP1-86500] - Staining of mouse E11 embryonic brain shows moderate nuclear positivity in the developing cortical plate.
Immunohistochemistry-Paraffin: Emx1 Antibody [NBP1-86500] - Staining of human kidney shows moderate nuclear positivity in cells in a subset of renal tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Emx1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RSLYGGPELVFPEAMNHPALTVHPAHQLGASPLQPPHSFFGAQHRDPLHFYPWVLRNRFFGHRFQASDVPQDGLLLHGPFARKPKRI
Specificity
Specificity of human Emx1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EMX1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control
Human Brain Cerebral Cortex Whole Tissue Lysate (Adult Whole Normal)
Control Peptide
Publications
Read Publication using NBP1-86500.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23995685)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Emx1 Antibody

  • empty spiracles homeobox 1
  • empty spiracles-like protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-39052
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1979
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NB300-750
Species: Hu, Mu, Rt, Fi, Mk, Pm, Sh
Applications: WB, ICC/IF, IHC, IP
H00005013-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, RNAi
H00001746-M06
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP1-56594
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-61435
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-67184
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
AF2567
Species: Mu
Applications: WB, IHC
NBP2-16178
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr
NBP1-02161
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
MAB6166
Species: Hu
Applications: WB, CyTOF-ready, ICC, ICFlow
MAB3314
Species: Hu, Rt
Applications: IHC
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IF
NBP1-86500
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for Emx1 Antibody (NBP1-86500)(1)


Reviews for Emx1 Antibody (NBP1-86500) (0)

There are no reviews for Emx1 Antibody (NBP1-86500). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Emx1 Antibody (NBP1-86500) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Emx1 Products

Bioinformatics Tool for Emx1 Antibody (NBP1-86500)

Discover related pathways, diseases and genes to Emx1 Antibody (NBP1-86500). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Emx1 Antibody (NBP1-86500)

Discover more about diseases related to Emx1 Antibody (NBP1-86500).
 

Pathways for Emx1 Antibody (NBP1-86500)

View related products by pathway.

PTMs for Emx1 Antibody (NBP1-86500)

Learn more about PTMs related to Emx1 Antibody (NBP1-86500).

Blogs on Emx1

There are no specific blogs for Emx1, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Emx1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EMX1
COVID-19 update