EMX2 Antibody

Images

 
Western Blot: EMX2 Antibody [H00002018-D01P] - Analysis of EMX2 expression in mouse liver.
Western Blot: EMX2 Antibody [H00002018-D01P] - Analysis of EMX2 expression in transfected 293T cell line by EMX2 polyclonal antibody.Lane 1: EMX2 transfected lysate(27.72 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EMX2 Antibody Summary

Immunogen
EMX2 (NP_004089.1, 1 a.a. - 252 a.a.) full-length human protein. MFQPAPKRCFTIESLVAKDSPLPASRSEDPIRPAALSYANSSPINPFLNGFHSAAAAAAGRGVYSNPDLVFAEAVSHPPNPAVPVHPVPPPHALAAHPLPSSHSPHPLFASQQRDPSTFYPWLIHRYRYLGHRFQGNDTSPESFLLHNALARKPKRIRTAFSPSQLLRLEHAFEKNHYVVGAERKQLAHSLSLTETQVKVWFQNRRTKFKRQKLEEEGSDSQQKKKGTHHINRWRIATKQASPEEIDVTSDD
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EMX2
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EMX2 Antibody

  • empty spiracles homeobox 2
  • empty spiracles homolog 2 (Drosophila)
  • Empty spiracles homolog 2
  • Empty spiracles-like protein 2
  • EMX2
  • homeobox protein EMX2

Background

The homeodomain transcription factor EMX2 is critical for central nervous system and urogenital development. EMX1 (MIM 600034) and EMX2 are related to the 'empty spiracles' gene expressed in the developing Drosophila head.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86500
Species: Hu
Applications: IHC, IHC-P
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
423-F8/CF
Species: Hu, Mu
AF1979
Species: Hu
Applications: WB, Simple Western, ICC
NB600-1081
Species: Mu, Rt
Applications: WB, IHC, IHC-P
H00005013-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, RNAi
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
PP-H8132-00
Species: Hu
Applications: WB, IHC, IP
NBP1-87769
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29861
Species: Mu
Applications: WB
NB110-60011
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, IP
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
H00002316-M01
Species: Hu
Applications: WB, ELISA, IHC-P, PLA
AF3690
Species: Hu, Mu
Applications: WB, ChIP, ICC
NBP2-01926
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00002018-D01P
Species: Hu, Mu
Applications: WB

Publications for EMX2 Antibody (H00002018-D01P) (0)

There are no publications for EMX2 Antibody (H00002018-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EMX2 Antibody (H00002018-D01P) (0)

There are no reviews for EMX2 Antibody (H00002018-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EMX2 Antibody (H00002018-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EMX2 Products

Bioinformatics Tool for EMX2 Antibody (H00002018-D01P)

Discover related pathways, diseases and genes to EMX2 Antibody (H00002018-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EMX2 Antibody (H00002018-D01P)

Discover more about diseases related to EMX2 Antibody (H00002018-D01P).
 

Pathways for EMX2 Antibody (H00002018-D01P)

View related products by pathway.

PTMs for EMX2 Antibody (H00002018-D01P)

Learn more about PTMs related to EMX2 Antibody (H00002018-D01P).

Blogs on EMX2

There are no specific blogs for EMX2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EMX2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EMX2
Entrez
Uniprot