![Western Blot: EMP2 Antibody [NBP1-62705] - analysis of EMP2 in EMP2 overexpression lysate (Cat# NBL1-10260) and recombinant protein using anti-EMP2 antibody. Image from verified customer review.](http://images.novusbio.com/fullsize/EMP2-Antibody-Western-Blot-NBP1-62705-img0005.jpg "Western Blot: EMP2 Antibody [NBP1-62705] - analysis of EMP2 in EMP2 overexpression lysate (Cat# NBL1-10260) and recombinant protein using anti-EMP2 antibody. Image from verified customer review.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Concentration | 1 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptides corresponding to EMP2(epithelial membrane protein 2) The peptide sequence was selected from the middle region of EMP2. Peptide sequence IQLMSCLCVMIAASIYTDRREDIHDKNAKFYPVTREGSYGYSYILAWVAF. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | EMP2 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Theoretical MW | 18 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Reviewed Applications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 1 mg/ml |
| Purity | Protein A purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
WB | Human | 05/22/2015 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for EMP2 Antibody (NBP1-62705)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: EMP2 Antibody [NBP1-62705] - Human Lung Alveolar cells (indicated with arrows), 4-8ug/ml.](http://images.novusbio.com/fullsize/EMP2-Antibody-Immunohistochemistry-Paraffin-NBP1-62705-img0003.jpg "Immunohistochemistry-Paraffin: EMP2 Antibody [NBP1-62705] - Human Lung Alveolar cells (indicated with arrows), 4-8ug/ml.")
![Western Blot: EMP2 Antibody [NBP1-62705] - HepG2 cell lysate, Antibody Titration: 1.25ug/ml](http://images.novusbio.com/fullsize/EMP2-Antibody-Western-Blot-NBP1-62705-img0004.jpg "Western Blot: EMP2 Antibody [NBP1-62705] - HepG2 cell lysate, Antibody Titration: 1.25ug/ml")
![Immunohistochemistry FAK Antibody (495919) [Unconjugated]](https://images.novusbio.com/images2/FAK_MAB4467_Immunohistochemistry_10745.jpg)
![Western Blot FAK Antibody (495919) [Unconjugated]](https://images.novusbio.com/images2/FAK_MAB4467_Western_Blot_6185.jpg)
![Knockout Validated FAK Antibody (495919) [Unconjugated]](https://images.novusbio.com/images2/FAK_MAB4467_Knockout_Validated_22784.jpg)
![Western Blot Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_Western_Blot_10680.jpg)
![Immunohistochemistry Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_Immunohistochemistry_10732.jpg)
![ELISA Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_ELISA_22233.jpg)
![Flow Cytometry CD155/PVR Antibody (300907) [Unconjugated]](https://images.novusbio.com/images2/CD155_MAB25301_Flow_Cytometry_20610.jpg)
![Flow Cytometry CD155/PVR Antibody (300907) [Unconjugated]](https://images.novusbio.com/images2/CD155_MAB25301_Flow_Cytometry_20611.jpg)
![Immunocytochemistry CD155/PVR Antibody (300907) [Unconjugated]](https://images.novusbio.com/images2/CD155_MAB25301_Immunocytochemistry__Immunofluorescence_17423.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
