EML1 Antibody

Images

 
Western Blot: EML1 Antibody [NBP1-56595] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EML1 Antibody Summary

Immunogen
Synthetic peptides corresponding to EML1(echinoderm microtubule associated protein like 1) The peptide sequence was selected from the C terminal of EML1. Peptide sequence YPCSQFRAPSHIYGGHSSHVTNVDFLCEDSHLISTGGKDTSIMQWRVI.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EML1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against EML1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for EML1 Antibody

  • echinoderm microtubule associated protein like 1
  • ELP79
  • EMAP1
  • EMAP-1
  • EMAPechinoderm microtubule-associated protein-like 1
  • EMAPL1
  • EMAPLhuEMAP-1
  • FLJ45033
  • HuEMAP
  • HuEMAP-1

Background

Human echinoderm microtubule-associated protein-like is a strong candidate for the Usher syndrome type 1A gene. Usher syndromes (USHs) are a group of genetic disorders consisting of congenital deafness, retinitis pigmentosa, and vestibular dysfunction of variable onset and severity depending on the genetic type. The disease process in USHs involves the entire brain and is not limited to the posterior fossa or auditory and visual systems. The USHs are catagorized as type I (USH1A, USH1B, USH1C, USH1D, USH1E and USH1F), type II (USH2A and USH2B) and type III (USH3). The type I is the most severe form. Human echinoderm microtubule-associated protein-like is a strong candidate for the Usher syndrome type 1A gene. Usher syndromes (USHs) are a group of genetic disorders consisting of congenital deafness, retinitis pigmentosa, and vestibular dysfunction of variable onset and severity depending on the genetic type. The disease process in USHs involves the entire brain and is not limited to the posterior fossa or auditory and visual systems. The USHs are catagorized as type I (USH1A, USH1B, USH1C, USH1D, USH1E and USH1F), type II (USH2A and USH2B) and type III (USH3). The type I is the most severe form. Gene loci responsible for these three types are all mapped. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-27080
Species: Hu, Mu, Rt, Po, Bv, ChHa, Eq, GP, Other, Pm
Applications: WB, Simple Western
NBP2-36751
Species: Hu
Applications: WB, ICC/IF, IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-1028
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, ICC
NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34954
Species: Hu
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005025-B01P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP1-86889
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
NB120-15106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-87201
Species: Hu
Applications: WB, IHC, IHC-P
AF3700
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-56595
Species: Hu
Applications: WB

Publications for EML1 Antibody (NBP1-56595) (0)

There are no publications for EML1 Antibody (NBP1-56595).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EML1 Antibody (NBP1-56595) (0)

There are no reviews for EML1 Antibody (NBP1-56595). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EML1 Antibody (NBP1-56595) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EML1 Products

Bioinformatics Tool for EML1 Antibody (NBP1-56595)

Discover related pathways, diseases and genes to EML1 Antibody (NBP1-56595). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EML1 Antibody (NBP1-56595)

Discover more about diseases related to EML1 Antibody (NBP1-56595).
 

Pathways for EML1 Antibody (NBP1-56595)

View related products by pathway.

PTMs for EML1 Antibody (NBP1-56595)

Learn more about PTMs related to EML1 Antibody (NBP1-56595).

Blogs on EML1

There are no specific blogs for EML1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EML1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EML1
Uniprot