Recombinant Human EMI1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human EMI1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 358-446 of Human FBXO5 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:RHNEFSEVAKTLKKNESLKACIRCNSPAKYDCYLQRATCKREGCGFDYCTKCLCNYHTTKDCSDGKLLKASCKIGPLPGTKKSKKNLRR

Protein/Peptide Type
Partial Recombinant Protein
Gene
FBXO5

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
20 mM Tris-HCl, 1 mM EDTA, pH 8.0, 1 mM dithiothreitol, 10% glycerol

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human EMI1 Protein

  • EMI1Early mitotic inhibitor 1
  • F-box only protein 5
  • F-box protein 5
  • FBX5F-box protein Fbx5
  • Fbxo31

Background

FBXO5 - F-box protein 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
MAB7675
Species: Hu
Applications: WB, Simple Western, ICC
NBP2-15840
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00051053-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-31473
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-59828
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB100-2567
Species: Hu
Applications: WB, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31541
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38092
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
H00026271-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for EMI1 Partial Recombinant Protein (H00026271-Q01) (0)

There are no publications for EMI1 Partial Recombinant Protein (H00026271-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EMI1 Partial Recombinant Protein (H00026271-Q01) (0)

There are no reviews for EMI1 Partial Recombinant Protein (H00026271-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EMI1 Partial Recombinant Protein (H00026271-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EMI1 Products

Bioinformatics Tool for EMI1 Partial Recombinant Protein (H00026271-Q01)

Discover related pathways, diseases and genes to EMI1 Partial Recombinant Protein (H00026271-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EMI1 Partial Recombinant Protein (H00026271-Q01)

Discover more about diseases related to EMI1 Partial Recombinant Protein (H00026271-Q01).
 

Pathways for EMI1 Partial Recombinant Protein (H00026271-Q01)

View related products by pathway.

PTMs for EMI1 Partial Recombinant Protein (H00026271-Q01)

Learn more about PTMs related to EMI1 Partial Recombinant Protein (H00026271-Q01).

Blogs on EMI1

There are no specific blogs for EMI1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GM-CSF [Unconjugated]
215-GM-010/CF
EMI1 Antibody
NBP1-84850

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human EMI1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FBXO5