EME1 Antibody

Western Blot: EME1 Antibody [NBP1-55350] - Titration: 0.2-1 ug/ml, Positive Control: HT1080 cell lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

EME1 Antibody Summary

• Immunogen: Synthetic peptides corresponding to EME1(essential meiotic endonuclease 1 homolog 1 (S. pombe)) The peptide sequence was selected from the middle region of EME1. Peptide sequence AYPSPQLLVQAYQQCFSDKERQNLLADIQVRRGEGVTSTSRRIGPELSRR. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EME1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against EME1 and was validated on Western blot.
• Theoretical MW: 63 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for EME1 Antibody

• crossover junction endonuclease EME1
• EC 3.1.22
• EC 3.1.22.-
• essential meiotic endonuclease 1 homolog 1 (S. pombe)
• essential meiotic endonuclease 1 homolog 2
• FLJ31364
• hMMS4
• homolog of yeast EME1 endonuclease
• MMS4 homolog
• MMS4
• MMS4L
• SLX2 structure-specific endonuclease subunit homolog A
• SLX2A

Background

EME1 interacts with MUS81 to form a DNA structure-specific endonuclease with substrate preference for branched DNA structures with a 5'-end at the branch nick. Typical substrates include 3'-flap structures, replication forks and nicked Holliday junctions. EME1 may be required in mitosis for the processing of stalled or collapsed replication forks.EME1 and MUS81 (MIM 606591) form an endonuclease complex that cleaves branched DNA structures, especially those arising during stalled DNA replication (Abraham et al., 2003 [PubMed 14609959]).[supplied by OMIM].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EME1
• Uniprot:
  • Q96AY2(Human)