Recombinant Human ELSPBP1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ELSPBP1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-223 of Human ELSPBP1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MTRWSSYLLGWTTFLLYSYESSGGMHEECVFPFTYKGSVYFTCTHIHSLSPWCATRAVYNGQWKYCQSEDYPRCIFPFIYRGKAYNSCISQGSFLGSLWCSVTSVFDEKQQWKFCETNEYGGNSLRKPCIFPSIYRNNVVSDCMEDESNKLWCPTTENMDKDGKWSFCADTRISALVPGFPCHFPFNYKNKNYFNCTNKGSKENLVWCATSYNYDQDHTWVYC

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
ELSPBP1

Applications/Dilutions

Dilutions
  • Western Blot Western Blot
Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ELSPBP1 Protein

  • E12epididymal protein 12
  • EDDM12
  • Epididymal secretory protein 12
  • epididymal sperm binding protein 1
  • epididymal sperm-binding protein 1
  • HE12

Background

ELSPBP1( AAH15598, 1 a.a. - 224 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7650
Species: Mu
Applications: WB, IHC
NBP2-50465
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Flow-CS
AF6116
Species: Hu
Applications: WB, ICC
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NB100-56510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
AF4377
Species: Hu, Mu
Applications: WB, ICC
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
H00064100-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for ELSPBP1 Recombinant Protein (H00064100-P01) (0)

There are no publications for ELSPBP1 Recombinant Protein (H00064100-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ELSPBP1 Recombinant Protein (H00064100-P01) (0)

There are no reviews for ELSPBP1 Recombinant Protein (H00064100-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ELSPBP1 Recombinant Protein (H00064100-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ELSPBP1 Products

Bioinformatics Tool for ELSPBP1 Recombinant Protein (H00064100-P01)

Discover related pathways, diseases and genes to ELSPBP1 Recombinant Protein (H00064100-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

PTMs for ELSPBP1 Recombinant Protein (H00064100-P01)

Learn more about PTMs related to ELSPBP1 Recombinant Protein (H00064100-P01).

Blogs on ELSPBP1

There are no specific blogs for ELSPBP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ELSPBP1 Antibody
NBP2-13958

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ELSPBP1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ELSPBP1