ELK4 Antibody

Images

 
Western Blot: ELK4 Antibody [NBP1-69129] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ELK4 Antibody Summary

Immunogen
Synthetic peptides corresponding to ELK4 (ELK4, ETS-domain protein (SRF accessory protein 1)) The peptide sequence was selected from the C terminal of ELK4. Peptide sequence ASLTPAFFSQVACSLFMVSPLLSFICPFKQIQNLYTQVCFLLLRFVLERL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ELK4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ELK4 and was validated on Western blot.
Theoretical MW
45 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ELK4 Antibody

  • ELK4, ETS-domain protein (SRF accessory protein 1)
  • ETS-domain protein
  • SAP-1
  • SAP1ETS domain-containing protein Elk-4
  • Serum response factor accessory protein 1
  • SRF accessory protein 1

Background

The ELK4 gene is a member of the Ets family of transcription factors and of the ternary complex factor (TCF) subfamily. Proteins of the TCF subfamily form a ternary complex by binding to the the serum response factor and the serum reponse element in the promoter of the c-fos proto-oncogene. The protein encoded by ELK4 is phosphorylated by the kinases, MAPK1 and MAPK8.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01264
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87814
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30646
Species: Hu
Applications: WB, IHC, IHC-P
PPS021
Species: Hu, Mu, Rt, Ca, Pm, Ze
Applications: WB
PPS021
Species: Hu, Mu, Rt, Ca, Pm, Ze
Applications: WB
H00023415-R03
Species: Hu
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
AF2558
Species: Hu, Mu
Applications: WB, Simple Western
H00004068-M01
Species: Hu
Applications: WB, ELISA
NBP2-37422
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-84505
Species: Hu
Applications: IHC, IHC-P
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-47289
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52884
Species: Hu
Applications: WB, IHC, IHC-P
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-69129
Species: Hu
Applications: WB

Publications for ELK4 Antibody (NBP1-69129) (0)

There are no publications for ELK4 Antibody (NBP1-69129).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ELK4 Antibody (NBP1-69129) (0)

There are no reviews for ELK4 Antibody (NBP1-69129). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ELK4 Antibody (NBP1-69129) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ELK4 Products

Bioinformatics Tool for ELK4 Antibody (NBP1-69129)

Discover related pathways, diseases and genes to ELK4 Antibody (NBP1-69129). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ELK4 Antibody (NBP1-69129)

Discover more about diseases related to ELK4 Antibody (NBP1-69129).
 

Pathways for ELK4 Antibody (NBP1-69129)

View related products by pathway.

PTMs for ELK4 Antibody (NBP1-69129)

Learn more about PTMs related to ELK4 Antibody (NBP1-69129).

Blogs on ELK4

There are no specific blogs for ELK4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ELK4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ELK4