Home » ELF2 » ELF2 Proteins » ELF2 Recombinant Protein Antigen

ELF2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for ELF2 Recombinant Protein Antigen (NBP2-49646PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

ELF2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ELF2.

Source: E. coli

Amino Acid Sequence: TQQASGQTPPRVISAVIKGPEVKSEAVAKKQEHDVKTLQLVEEKPADGNKTVTHVVVVSAPSAIALPVTMKTEGLVTCEK
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ELF2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-49646.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for ELF2 Recombinant Protein Antigen

  • b
  • E74-like factor 2 (ets domain transcription factor)
  • E74-like factor 2
  • ets family transcription factor ELF2C
  • ETS-related transcription factor Elf-2
  • NERF-1a
  • NERF-1B
  • NERF-2
  • NERFEU32
  • New ETS-related factor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Ephrin-A2
8415-A2
Ephrin-A2
Species: Mu
GADD153/CHOP
Antibody (9C8)
NB600-1335
Western Blot: GADD153/CHOP Antibody (9C8) [NB600-1335] - Ethanol feeding increases CHOP expression. Image from verified customer review.
Immunohistochemistry-Paraffin: GADD153/CHOP Antibody (9C8) [NB600-1335] - FFPE tissue section of mouse brain using 1:100 dilution of GADD153/CHOP antibody. The signal was developed using HRP-DAB based detection method which followed counterstaining of the nuclei with hematoxylin. The antibody generated a cytoplasmic and nuclear staining of CHOP in various cell types in the tested section.
Western Blot: GADD153/CHOP Antibody (9C8) [NB600-1335] - GADD153/CHOP expression in HeLa cells treated with 2.5 ug/mL tunicamycin for 4 hours (Lane 1) and untreated (Lane 2).
(3 Reviews)
(34 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, GS, ICC/IF, IHC, IHC-P, IP, ChIP, KD
ELOF1 Antibody
NBP1-91868
Immunocytochemistry/Immunofluorescence: ELOF1 Antibody [NBP1-91868] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: ELOF1 Antibody [NBP1-91868] - Staining of human lateral ventricle shows strong cytoplasmic positivity in neuronal cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
E74 like factor 1
Antibody
NB100-1069
Western Blot: E74 like factor 1 Antibody [NB100-1069] - (0.3ug/ml) staining of Human Lymph Node (A), Human Tonsil (B) and Mouse Thymus (C) lysates (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
Immunohistochemistry-Paraffin: E74 like factor 1 Antibody [NB100-1069] - Staining of paraffin embedded Human Thymus. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Western Blot: E74 like factor 1 Antibody [NB100-1069] - (0.1ug/ml) staining of Jurkat cell lysate (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
(1 Publication)
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
Ets-1 Antibody
(JM92-32)
NBP2-66826
Western Blot: Ets-1 Antibody (JM92-32) [NBP2-66826] - Analysis of ETS1 on different cell lysates using anti-ETS1 antibody at 1/1,000 dilution. Positive control: Line1: Jurkat Line2: K562 Line3: HepG2
Immunohistochemistry-Paraffin: Ets-1 Antibody (JM92-32) [NBP2-66826] - Analysis of paraffin-embedded mouse spleen tissue using anti-ETS1 antibody. Counter stained with hematoxylin.
Flow Cytometry: Ets-1 Antibody (JM92-32) [NBP2-66826] - Analysis of Jurkat cells with ETS1 antibody at 1/100 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black).
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
ETV6/Tel Antibody
NBP1-80695
Western Blot: ETV6/Tel Antibody [NBP1-80695] - Analysis in human cell lines U2OS and Caco-2. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Immunocytochemistry/Immunofluorescence: ETV6/Tel Antibody [NBP1-80695] - Staining of human cell line U-2 OS shows localization to nucleoli & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ETV6/Tel Antibody [NBP1-80695] - Staining of human liver shows no positivity in hepatocytes as expected.
(2 Publications)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Blk Antibody (7A12)
H00000640-M02
Western Blot: Blk Antibody (7A12) [H00000640-M02] - Analysis of BLK expression in transfected 293T cell line by BLK monoclonal antibody (M02), clone 7A12.Lane 1: BLK transfected lysate (Predicted MW: 57.7 KDa).Lane 2: Non-transfected lysate.
Western Blot: Blk Antibody (7A12) [H00000640-M02] - BLK monoclonal antibody (M02), clone 7A12. Analysis of BLK expression in PC-12.
Western Blot: Blk Antibody (7A12) [H00000640-M02] - BLK monoclonal antibody (M02), clone 7A12. Analysis of BLK expression in Raw 264.7.
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow
RUNX1/CBFA2
Antibody
NBP1-89105
Immunohistochemistry-Paraffin: RUNX1/CBFA2 Antibody [NBP1-89105] - Staining in human breast and liver tissues using NBP1-89105 antibody. Corresponding RUNX1 RNA-seq data are presented for the same tissues.
Immunocytochemistry/Immunofluorescence: RUNX1/CBFA2 Antibody [NBP1-89105] - Staining human cell line A-431 shows localization to nucleoplasm & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RUNX1/CBFA2 Antibody [NBP1-89105] - Staining of human breast shows moderate to strong nuclear positivity in glandular cells.
(1 Review)
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Elf4/MEF Antibody
NBP2-33286
Immunohistochemistry-Paraffin: Elf4/MEF Antibody [NBP2-33286] - Staining in human stomach and cerebral cortex tissues using anti-ELF4 antibody. Corresponding ELF4 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Elf4/MEF Antibody [NBP2-33286] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: Elf4/MEF Antibody [NBP2-33286] - Staining of human stomach shows high expression.
Species: Hu
Applications: IHC, IHC-P
ATF6 Antibody
(70B1413.1)
NBP1-40256
Western Blot: ATF6 Antibody (70B1413.1) [NBP1-40256] - Hypoxia leads to EMT and ER-stress in CRC cells. B. C. Confluent growing SW480 (B) and HCT116 (C) cells were cultured under conditions of normoxia or hypoxia-like conditions (serum free; 100 uM CoCl2, 1-9 h. B-actin (B-act) as loading control. HIF1a was detectable after 3 h of CoCl2 incubation, the amount of the 50 kD-ATF6 fragment, was already enhanced after 1 h of addition of CoCl2. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0087386) licensed under a CC-BY licence.
Western Blot: ATF6 Antibody (70B1413.1) [NBP1-40256] - Analysis of ATF6 in mouse liver tissue using 3 ug/ml of ATF6 antibody and 0.25 ug/ml of GAPDH antibody. Lane A contains 20 ugs of whole mouse liver lysate, lane B contains 20 ugs of total ER fraction, and lane C contains 20 ugs of rough ER fraction. The ATF6 band may represent under glycosylated or cleaved/active ATF6.
Immunocytochemistry/Immunofluorescence: ATF6 Antibody (70B1413.1) [NBP1-40256] - Untreated HeLa cells were fixed in -20C methanol for 10 min, air dried and rehydrated in PBS at room temperature for 5 minutes. Cells were incubated with anti-ATF6 (1:20) for one hour at room temperature. ATF6 reactivity (green) was detected with anti-mouse Dylight-488 secondary antibody. Nuclei were counterstained with DAPI (blue). Note the ER localization of ATF6.
(2 Reviews)
(201 Publications)
Species: Hu, Mu, Rt, Po, Rb
Applications: WB, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC, KO
p97/VCP Antibody
NB100-1558
Western Blot: p97/VCP Antibody [NB100-1558] - Zymographic assay of gelatinase activity. Medium supernatants of 20ml culture medium (medium control) as well as 20 ml conditioned medium from 107 U937 cells, pMTH1-U937 cells and asCD11b-U937 cells in the absence or presence of 5nM TPA for 72 h, respectively, were 18-fold concentrated and subjected to SDS-PAGE containing 2 mg/ml of gelatine. Following incubation with MMP enzyme buffer, the gels were stained with 0.4% Coomassie blue and afterwards destained again to visualize the appearance of gelatinase activity by light bands against the dark background. The molecular weight markers on both sides of the gels indicate the size of the MMPs exhibiting gelatinase activities. Image collected and cropped by CiteAb from the following publication (http://biosignaling.biomedcentral.com/articles/10.1186/1478-811X-10-13) licensed under a CC-BY licence.
Western Blot: p97/VCP Antibody [NB100-1558] - Whole cell lysate (15 ug) from HeLa, 293T, Jurkat, mouse TCMK-1, and mouse NIH3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit antiVCP antibody used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 1 second.
Western Blot: p97/VCP Antibody [NB100-1558] - Detection of human VCP by western blot of immunoprecipitates. Samples: Whole cell lysate (1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-VCP antibody NB100-1558 used for IP at 3 ug per reaction. VCP was also immunoprecipitated by rabbit anti-VCP antibody NB100-1557. For blotting immunoprecipitated VCP, NB100-1558 was used at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 1 second.
(10 Publications)
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
GRP78/HSPA5
Antibody
NBP1-06274
Simple Western: GRP78/HSPA5 Antibody [NBP1-06274] - Image shows a specific band for GRP78 in 0.1 mg/mL of HeLa lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Western Blot: GRP78/HSPA5 Antibody [NBP1-06274] - C. elegans granulins impair organismal fitness and resistance to ER stress. Total worm lysates from synchronized day 1 adult granulin-expressing animals were immunoblotted with an anti-GRP78/HSPA5 antibody (3 biological replicates). Anti-actin was used as a loading control. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pgen.1008295), licensed under a CC-BY licence.
Western Blot: GRP78/HSPA5 Antibody [NBP1-06274] - Analysis of MAM-associated protein levels in control and patients' fibroblasts.(A) Equal amounts from one control and the five patients were loaded (50 ug of total cell lysates) and subjected to Western Blot with anti-Grp75, anti-sigma-1R and anti-Mfn2 antibodies. We used anti-GAPDH antibody to ensure equal amounts of protein loaded in each lane. This result is representative of three independent experiments. PLoS One. 2016 Mar 9;11(3):e0150357. doi: 10.1371/journal.pone.0150357
(2 Reviews)
(26 Publications)
Species: Hu, Mu, Rt, Ce, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IHC-FrFl
Tie-2 Antibody
[Unconjugated]
AF313
Western blot shows lysate of HUVEC human umbilical vein endothelial cells. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human Tie‑2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF313) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Tie‑2 at approximately 150 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of HUVEC human umbilical vein endothelial cells, loaded at 0.2 mg/mL. A specific band was detected for Tie‑2 at approximately 161 kDa (as indicated) using 10 µg/mL of Goat Anti-Human Tie‑2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF313) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Tie‑2 was detected in immersion fixed paraffin-embedded sections of human placenta using Goat Anti-Human Tie‑2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF313) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(2 Reviews)
(23 Publications)
Species: Hu
Applications: WB, Simple Western, IHC, Block
MEFV Antibody
NBP2-17262
Western Blot: MEFV Antibody [NBP2-17262] - Whole cell extract (30 ug) was separated by 7.5% SDS-PAGE, and the membrane was blotted with MEFV antibody [N3C1], Internal diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: MEFV Antibody [NBP2-17262] - Immunofluorescence analysis of paraformaldehyde-fixed A431, using antibody at 1:500 dilution.
Western Blot: MEFV Antibody [NBP2-17262] - Various whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with MEFV antibody diluted at 1:1000. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Species: Hu
Applications: WB, ICC/IF
Tie-1 Antibody
[Unconjugated]
AF619
Tie‑1 was detected in immersion fixed paraffin-embedded sections of human placenta using 8 µg/mL Goat Anti-Human Tie‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF619) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counter­stained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
HUVEC human umbilical vein endothelial cells were stained with Goat Anti-Human Tie‑1 Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF619, filled histogram) or control antibody (Catalog # AB-108-C, open histogram), followed by Phycoerythrin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0107).
(1 Review)
(7 Publications)
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
SPDEF Antibody
NBP3-04686
Western Blot: SPDEF Antibody [NBP3-04686] - Analysis of extracts of rat ovary, using SPDEF antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit.
Immunocytochemistry/Immunofluorescence: SPDEF Antibody [NBP3-04686] - Analysis of MCF7 cells using SPDEF antibody.
Immunohistochemistry-Paraffin: SPDEF Antibody [NBP3-04686] - Human placenta using SPDEF antibody at dilution of 1:100 (40x lens).
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
ELF3/ESE-1 Antibody
NBP1-30873
Western Blot: ELF3/ESE-1 Antibody [NBP1-30873] - Loss of Elf3 preserves the mesenchymal state. Immunoblot showing ELF3 and E-cadherin protein levels in response to Elf3 silencing by siRNAs. Image collected and cropped by CiteAb from the following publication (https://www.mdpi.com/2073-4409/8/8/858) licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: ELF3/ESE-1 Antibody [NBP1-30873] - Methanol-fixed HeLa, using antibody at 1:500 dilution.
Immunohistochemistry-Paraffin: ELF3/ESE-1 Antibody [NBP1-30873] - Paraffin-embedded human lung carcinoma. ESE1 antibody [C2C3], C-term diluted at 1:500.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, ChIP
CD79A Antibody
(HM57)
NB100-64347
Immunohistochemistry: CD79A Antibody (HM57) [NB100-64347] - Paraffin-embedded alcohol fixed Rat Spleen tissue (20x). Antigen retrieval pH6. Dilution: 1:500 and ON incubation at 4C. This image was submitted via customer revies.
Flow Cytometry: CD79A Antibody (HM57) [NB100-64347] - Using the Allophycocyanin direct conjugate An intracellular stain was performed on Daudi cells with CD79A (HM 57) antibody NB100-64347APC (blue) and a matched isotype control NBP1-97005APC (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 0.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Allophycocyanin.
Immunohistochemistry-Paraffin: CD79A Antibody (HM57) [NB100-64347] - Embedded human tonsil.
(2 Reviews)
(2 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq, Ma, Gt, Gp, Pm, Rb
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for ELF2 Recombinant Protein Antigen (NBP2-49646PEP) (0)

There are no publications for ELF2 Recombinant Protein Antigen (NBP2-49646PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ELF2 Recombinant Protein Antigen (NBP2-49646PEP) (0)

There are no reviews for ELF2 Recombinant Protein Antigen (NBP2-49646PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ELF2 Recombinant Protein Antigen (NBP2-49646PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Learn about Custom Antibody Labeling

Additional ELF2 Products

Bioinformatics Tool for ELF2 Recombinant Protein Antigen (NBP2-49646PEP)

Discover related pathways, diseases and genes to ELF2 Recombinant Protein Antigen (NBP2-49646PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ELF2 Recombinant Protein Antigen (NBP2-49646PEP)

Discover more about diseases related to ELF2 Recombinant Protein Antigen (NBP2-49646PEP).
 

Pathways for ELF2 Recombinant Protein Antigen (NBP2-49646PEP)

View related products by pathway.

PTMs for ELF2 Recombinant Protein Antigen (NBP2-49646PEP)

Learn more about PTMs related to ELF2 Recombinant Protein Antigen (NBP2-49646PEP).

Blogs on ELF2

There are no specific blogs for ELF2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Western Blot: ATF6 Antibody (70B1413.1) [NBP1-40256] - Hypoxia leads to EMT and ER-stress in CRC cells. B. C. Confluent growing SW480 (B) and HCT116 (C) cells were cultured under conditions of normoxia or hypoxia-like conditions (serum free; 100 uM CoCl2, 1-9 h. B-actin (B-act) as loading control. HIF1a was detectable after 3 h of CoCl2 incubation, the amount of the 50 kD-ATF6 fragment, was already enhanced after 1 h of addition of CoCl2. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0087386) licensed under a CC-BY licence.
ATF6 Antibody (70B1413.1)
NBP1-40256-0.1mg
Western Blot: GADD153/CHOP Antibody (9C8) [NB600-1335] - Ethanol feeding increases CHOP expression. Image from verified customer review.
GADD153/CHOP Antibody (9C8)
NB600-1335

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ELF2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ELF2