eIF5A Antibody (8C1)

Images

 
Western Blot: eIF5A Antibody (8C1) [H00001984-M01] - Analysis of EIF5A expression in transfected 293T cell line by EIF5A monoclonal antibody (M01), clone 8C1.Lane 1: EIF5A transfected lysate(16.8 KDa).Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: eIF5A Antibody (8C1) [H00001984-M01] - Analysis of monoclonal antibody to EIF5A on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: eIF5A Antibody (8C1) [H00001984-M01] - Detection limit for recombinant GST tagged EIF5A is 3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
8C1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

eIF5A Antibody (8C1) Summary

Immunogen
EIF5A (NP_001961.1, 1 a.a. - 154 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMAK
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
EIF5A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for eIF5A Antibody (8C1)

  • eIF4D
  • eIF-4D
  • eIF5A
  • EIF-5A
  • EIF5A1
  • eIF-5A1
  • eIF-5A-1
  • eIF5AI
  • Eukaryotic initiation factor 5A isoform 1
  • eukaryotic initiation factor 5A
  • eukaryotic translation initiation factor 5A
  • eukaryotic translation initiation factor 5A-1
  • MGC104255
  • MGC99547
  • Rev-binding Factor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91994
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85943
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32887
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE, IF
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP2-37620
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-86184
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP1-87094
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-86636
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77376
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP2-59411
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-16289
Species: Hu
Applications: WB
AF2969
Species: Mu
Applications: WB, IP
NBP1-85393
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for eIF5A Antibody (H00001984-M01) (0)

There are no publications for eIF5A Antibody (H00001984-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for eIF5A Antibody (H00001984-M01) (0)

There are no reviews for eIF5A Antibody (H00001984-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for eIF5A Antibody (H00001984-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional eIF5A Products

Bioinformatics Tool for eIF5A Antibody (H00001984-M01)

Discover related pathways, diseases and genes to eIF5A Antibody (H00001984-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for eIF5A Antibody (H00001984-M01)

Discover more about diseases related to eIF5A Antibody (H00001984-M01).
 

Pathways for eIF5A Antibody (H00001984-M01)

View related products by pathway.

PTMs for eIF5A Antibody (H00001984-M01)

Learn more about PTMs related to eIF5A Antibody (H00001984-M01).

Blogs on eIF5A

There are no specific blogs for eIF5A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our eIF5A Antibody (8C1) and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF5A
Entrez
Uniprot