eIF5A2 Antibody

Images

 
Western Blot: eIF5A2 Antibody [NBP1-85943] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: eIF5A2 Antibody [NBP1-85943] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Immunohistochemistry-Paraffin: eIF5A2 Antibody [NBP1-85943] - Staining of human hippocampus shows strong nuclear membranous positivity in neuronal cells.
Western Blot: eIF5A2 Antibody [NBP1-85943] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-182
Immunocytochemistry/ Immunofluorescence: eIF5A2 Antibody [NBP1-85943] - Staining of human cell line U-251MG shows positivity in vesicles.

Product Details

Summary
Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

eIF5A2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYAVA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EIF5A2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
eIF5A2 Protein (NBP1-85943PEP)
Publications
Read Publication using
NBP1-85943 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24484057).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for eIF5A2 Antibody

  • EIF-5A2
  • eIF-5A-2
  • eIF5AII
  • Eukaryotic initiation factor 5A isoform 2
  • eukaryotic initiation factor 5A
  • eukaryotic translation initiation factor 5A2
  • eukaryotic translation initiation factor 5A-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF7558
Species: Hu, Mu, Rt
Applications: WB
NBP1-82648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86184
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP1-91994
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58172
Species: Hu
Applications: WB
NBP2-32887
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE, IF
NBP1-78296
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-59438
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14801
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-288
Species: Hu, Xp
Applications: WB, IHC, IHC-P, IP, PLA
NBP1-85699
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-46403
Species: Hu
Applications: IHC

Publications for eIF5A2 Antibody (NBP1-85943)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for eIF5A2 Antibody (NBP1-85943) (0)

There are no reviews for eIF5A2 Antibody (NBP1-85943). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for eIF5A2 Antibody (NBP1-85943) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional eIF5A2 Products

Bioinformatics Tool for eIF5A2 Antibody (NBP1-85943)

Discover related pathways, diseases and genes to eIF5A2 Antibody (NBP1-85943). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for eIF5A2 Antibody (NBP1-85943)

Discover more about diseases related to eIF5A2 Antibody (NBP1-85943).
 

Pathways for eIF5A2 Antibody (NBP1-85943)

View related products by pathway.

PTMs for eIF5A2 Antibody (NBP1-85943)

Learn more about PTMs related to eIF5A2 Antibody (NBP1-85943).
 

Research Areas for eIF5A2 Antibody (NBP1-85943)

Find related products by research area.

Blogs on eIF5A2

There are no specific blogs for eIF5A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our eIF5A2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF5A2