EIF4E3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: EIF4E3 Antibody [NBP2-54931] - Staining of human cell line SH-SY5Y shows localization to nucleoli fibrillar center.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

EIF4E3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LLATIGEQFTDCAAADDEVIGVSVSVRDREDVVQVWNVNASLVGEATVLEKIY
• Predicted Species: Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EIF4E3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  EIF4E3 Recombinant Protein Antigen (NBP2-54931PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for EIF4E3 Antibody - BSA Free

• eIF4E type 3
• eIF-4E type 3
• eIF-4E3
• eIF4E-3
• eukaryotic translation initiation factor 4E family member 3
• eukaryotic translation initiation factor 4E member 3
• eukaryotic translation initiation factor 4E type 3
• MGC39820
• MGC86971

Background

EIF4E3 belongs to the EIF4E family of translational initiation factors that interact with the 5-prime cap structure ofmRNA and recruit mRNA to the ribosome (Joshi et al., 2004 (PubMed 15153109)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EIF4E3