Immunohistochemistry-Paraffin: EIF3M Antibody [NBP1-56654] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.
TRS functions similarly to eIF4G & acts as an eIF4F analog. a Pull-down assay of co-expressed TRS-Strep with eIF4A- or eIF4G-FLAG in 293 T cells. TRS-Strep was pulled down with Strep-Tactin beads, & co-precipitation ...read more
TRS functions similarly to eIF4G & acts as an eIF4F analog. a Pull-down assay of co-expressed TRS-Strep with eIF4A- or eIF4G-FLAG in 293 T cells. TRS-Strep was pulled down with Strep-Tactin beads, & co-precipitation ...read more
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to EIF3M(eukaryotic translation initiation factor 3, subunit M) The peptide sequence was selected from the N terminal of EIF3M. Peptide sequence MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACD. The peptide sequence for this immunogen was taken from within the described region.
Specificity
This product is specific to Subunit or Isoform: M.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EIF3M
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
EIF3M is a broadly expressed protein containing putative membrane fusion domains that acts as a receptor or coreceptor for entry of herpes simplex virus (HSV).HFLB5 encodes a broadly expressed protein containing putative membrane fusion domains that acts as a receptor or coreceptor for entry of herpes simplex virus (HSV) (Perez et al., 2005 [PubMed 15919898]).[supplied by OMIM].
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our EIF3M Antibody - BSA Free and receive a gift card or discount.