EIF3J Antibody - Azide and BSA Free

Western Blot: EIF3J Antibody [NBP3-04592] - Analysis of extracts of various cell lines, using EIF3J antibody at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit

Immunocytochemistry/ Immunofluorescence: EIF3J Antibody - Azide and BSA Free [NBP3-04592] - Immunofluorescence analysis of PC-12 cells using EIF3J Rabbit pAb (A8637) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: EIF3J Antibody - Azide and BSA Free [NBP3-04592] - Immunofluorescence analysis of HeLa cells using EIF3J Rabbit pAb (A8637) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: EIF3J Antibody - Azide and BSA Free [NBP3-04592] - Immunofluorescence analysis of NIH/3T3 cells using EIF3J Rabbit pAb (A8637) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

EIF3J Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit EIF3J Antibody - Azide and BSA Free (NBP3-04592) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-258 of human EIF3J (NP_003749.2). MAAAAAAAGDSDSWDADAFSVEDPVRKVGGGGTAGGDRWEGEDEDEDVKDNWDDDDDEKKEEAEVKPEVKISEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEEPKVLTPEEQLADKLRLKKLQEESDLELAKETFGVNNAVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASFLEVLVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDLADYGGYDGGYVQDYEDFM
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EIF3J
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:200 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for EIF3J Antibody - Azide and BSA Free

• eIF3 p35
• eIF3-alpha
• eIF3j
• eIF3-p35
• EIF3S1eIF-3-alpha
• Eukaryotic translation initiation factor 3 subunit 1
• eukaryotic translation initiation factor 3 subunit J
• eukaryotic translation initiation factor 3, subunit 1 (alpha, 35kD)
• eukaryotic translation initiation factor 3, subunit 1 alpha, 35kDa
• eukaryotic translation initiation factor 3, subunit J

Background

Eukaryotic initiation factor-3 (EIF3) has a molecular mass of about 600 kD and contains 13 nonidentical protein subunits, including EIF3J. EIF3 plays a central role in binding of initiator methionyl-tRNA and mRNA to the 40S ribosomal subunit to form the 40S initiation complex (Fraser et al., 2004 [PubMed 14688252]; Fraser et al., 2007 [PubMed 17588516]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: EIF3J