eIF2B1 Antibody

Images

 
Western Blot: eIF2B1 Antibody [H00001967-B01P] - Analysis of EIF2B1 expression in human colon.
Western Blot: eIF2B1 Antibody [H00001967-B01P] - Analysis of EIF2B1 expression in transfected 293T cell line by EIF2B1 polyclonal antibody. Lane 1: EIF2B1 transfected lysate(33.55 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

eIF2B1 Antibody Summary

Immunogen
EIF2B1 (NP_001405.1, 1 a.a. - 305 a.a.) full-length human protein. MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKGETIQGLRANLTSAIETLCGVDSSVAVSSGGELFLRFISLASLEYSDYSKCKKIMIERGELFLRRISLSRNKIADLCHTFIKDGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLDAAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKLYL
Specificity
EIF2B1 - eukaryotic translation initiation factor 2B, subunit 1 alpha, 26kDa,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
EIF2B1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for eIF2B1 Antibody

  • eIF-2B GDP-GTP exchange factor subunit alpha
  • EIF2B
  • EIF-2B
  • EIF-2Balpha
  • EIF2BAMGC117409
  • eukaryotic translation initiation factor 2B, subunit 1 (alpha, 26kD)
  • eukaryotic translation initiation factor 2B, subunit 1 alpha, 26kDa
  • MGC125868
  • MGC125869
  • translation initiation factor eIF-2B subunit alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32783
Species: Hu, Mu
Applications: WB, ICC/IF
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NB200-157
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-268
Species: Hu, Rt, Po
Applications: WB, IP
AF6260
Species: Hu
Applications: WB
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-24529
Species: Hu, Mu, Ca, Ch, Pm
Applications: WB, Simple Western, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
AF8962
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-03605
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-38126
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00001967-B01P
Species: Hu
Applications: WB

Publications for eIF2B1 Antibody (H00001967-B01P) (0)

There are no publications for eIF2B1 Antibody (H00001967-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for eIF2B1 Antibody (H00001967-B01P) (0)

There are no reviews for eIF2B1 Antibody (H00001967-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for eIF2B1 Antibody (H00001967-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional eIF2B1 Products

Bioinformatics Tool for eIF2B1 Antibody (H00001967-B01P)

Discover related pathways, diseases and genes to eIF2B1 Antibody (H00001967-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for eIF2B1 Antibody (H00001967-B01P)

Discover more about diseases related to eIF2B1 Antibody (H00001967-B01P).
 

Pathways for eIF2B1 Antibody (H00001967-B01P)

View related products by pathway.

Blogs on eIF2B1

There are no specific blogs for eIF2B1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our eIF2B1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF2B1
Entrez
Uniprot