![Western Blot: GCN2 Antibody (6E2X0) [NBP3-16112] -Analysis of various lysates, using GCN2 Rabbit mAb at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.](http://images.novusbio.com/fullsize/nbp3-16112_rabbit-gcn2-mab-6e2x0-western-blot-206202310298..jpg "Western Blot: GCN2 Antibody (6E2X0) [NBP3-16112] -Analysis of various lysates, using GCN2 Rabbit mAb at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, IHC |
| Clone | 1G2Z4 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Description | Novus Biologicals Rabbit GCN2 Antibody (1G2Z4) (NBP3-16112) is a recombinant monoclonal antibody validated for use in IHC, WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human GCN2 (NP_001013725.2). MAGGRGAPGRGRDEPPESYPQRQDHELQALEAIYGADFQDLRPDACGPVKEPPEINLVLYPQGLTGEEVYVKVDLRVKCPPTYPDVVPEIELKNAKGLSNESVNLLKSRLEELAKKHCGEVMIFELAYHVQSFLSEHNKPPPKSFHEEMLERRAQEEQQRLLEAKRKEEQEQREILHEIQRRKEEIKEEKKRKEMAKQERLEIASLSNQDHTSKKDPGGHRTAAILHGGSPDFVGNGKHRANSSGRSRRERQYSVCNSEDSPGSCEILYFNMGSPDQLMVHKGKCIGSDEQLGKLVYNAL |
| Source | HEK293 |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | EIF2AK4 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 187 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.05% Proclin 300 |
| Purity | Affinity purified |
![Western Blot PKLR Antibody [Unconjugated]](https://images.novusbio.com/images2/PKLR_AF8519_Western_Blot_16592.jpg)
![Simple Western PKLR Antibody [Unconjugated]](https://images.novusbio.com/images2/af8519_human-mouse-rat-pklr-affinity-purified-pab-simple-western-1342022154119.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for GCN2 Antibody (NBP3-16112)Find related products by research area.
|
|
eIF2alpha - a regulator of global translation in response to cellular stress Eukaryotic initiation factor 2 (eIF2) regulates global protein translation by binding to Met-tRNA and the 40S ribosome to form the pre-initiation complex. eIF2 is a heterotrimer consisting of alpha, beta, and gamma subunits. The 36kDA eIF2a subuni... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | EIF2AK4 |
![Western Blot: GCN2 Antibody (6E2X0) [NBP3-16112] - Analysis of Rat brain, using GCN2 Rabbit mAb at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.](http://images.novusbio.com/fullsize/nbp3-16112_rabbit-gcn2-mab-6e2x0-western-blot-206202310312..jpg "Western Blot: GCN2 Antibody (6E2X0) [NBP3-16112] - Analysis of Rat brain, using GCN2 Rabbit mAb at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.")
![IHC-P-GCN2 Antibody (6E2X0) [NBP3-16112] -Analysis of paraffin-embedded mouse kidney using GCN2 Rabbit mAb at dilution of 1:500 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/nbp3-16112_rabbit-gcn2-mab-6e2x0-immunohistochemistry-paraffin-2062023103237..jpg "IHC-P-GCN2 Antibody (6E2X0) [NBP3-16112] -Analysis of paraffin-embedded mouse kidney using GCN2 Rabbit mAb at dilution of 1:500 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![IHC-P-GCN2 Antibody (6E2X0) [NBP3-16112] - Analysis of paraffin-embedded rat intestine using GCN2 Rabbit mAb at dilution of 1:500 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/nbp3-16112_rabbit-gcn2-mab-6e2x0-immunohistochemistry-paraffin-2062023103357..jpg "IHC-P-GCN2 Antibody (6E2X0) [NBP3-16112] - Analysis of paraffin-embedded rat intestine using GCN2 Rabbit mAb at dilution of 1:500 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Western Blot PERK Antibody [Unconjugated]](https://images.novusbio.com/images2/PERK_AF3999_Western_Blot_5379.jpg)
![Knockout Validated PERK Antibody [Unconjugated]](https://images.novusbio.com/images2/PERK_AF3999_Knockout_Validated_22482.jpg)
![Western Blot PERK Antibody [Unconjugated]](https://images.novusbio.com/images/af3999_human-perk-affinity-purified-polyclonal-ab-4120241240258.jpg)
![Immunohistochemistry-Paraffin TOR/mTOR [p Ser2448] Antibody - BSA Free](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-Immunohistochemistry-Paraffin-NB600-607-img0005.jpg)
![Western Blot TOR/mTOR [p Ser2448] Antibody - BSA Free](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-Western-Blot-NB600-607-img0006.jpg)
![Data TOR/mTOR [p Ser2448] Antibody - BSA Free](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-N-A-NB600-607-img0008.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")