eIF2 alpha/EIF2S1 Antibody - BSA Free Summary
| Description |
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen |
Synthetic peptides corresponding to EIF2S1(eukaryotic translation initiation factor 2, subunit 1 alpha, 35kDa) The peptide sequence was selected from the N terminal of EIF2S1 (NP_004085). Peptide sequence VVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLE The peptide sequence for this immunogen was taken from within the described region. |
| Specificity |
This product is specific to Subunit or Isoform: 1. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
EIF2S1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Theoretical MW |
36 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for eIF2 alpha/EIF2S1 Antibody - BSA Free
Background
EIF2S1, also known as eIF2a, is the alpha subunit of the translation initiation factor eIF2 complex which catalyzes the first regulated step of protein synthesis initiation, promoting the binding of the initiator tRNA to 40S ribosomal subunits. The phosphorylation state of eIF2S1 controls the rate of tRNA translation. When eIF2a is not phosphorylated, translation occurs at a normal rate. However, upon phosphorylation by one of several kinases, eIF2S1 is stabilized, thus preventing the GDP/GTP exchange reaction and slowing translation. Recombinant human EIF2S1 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Pm
Applications: ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Ca, Ch, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: KO, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Publications for eIF2 alpha/EIF2S1 Antibody (NBP1-57470) (0)
There are no publications for eIF2 alpha/EIF2S1 Antibody (NBP1-57470).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for eIF2 alpha/EIF2S1 Antibody (NBP1-57470) (0)
There are no reviews for eIF2 alpha/EIF2S1 Antibody (NBP1-57470).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for eIF2 alpha/EIF2S1 Antibody (NBP1-57470). (Showing 1 - 2 of 2 FAQ).
-
One of our customer is interested in testing NBP1-57470 in yeast. Do you have any data supporting this antibody works in yeast? If not it is possible to have a special discount with exchange of customer's results on the yeasts.
- We have not tested NBP1-57470 in yeast samples, and don't have any data to indicate whether it will work or not. We do have an Innovators Reward Program for customers who are interested in testing our products in new species or applications.
-
Should this antibody be stored at -20C lyophilized or do I suspend first and then store at -20C?
- We recommend that this antibody be stored at -20C in both lyophilized and reconstituted forms. Once reconstituted aliquot the antibody into smaller quantities to avoid freeze-thaw cycles and store at -20C.
Secondary Antibodies
| |
Isotype Controls
|
Additional eIF2 alpha/EIF2S1 Products
Research Areas for eIF2 alpha/EIF2S1 Antibody (NBP1-57470)
Find related products by research area.
|
Blogs on eIF2 alpha/EIF2S1