EHD4 Antibody - BSA Free

Immunohistochemistry-Paraffin: EHD4 Antibody [NBP2-33665] - Staining of human fallopian tube shows strong positivity in endothelial cells.

Immunohistochemistry-Paraffin: EHD4 Antibody [NBP2-33665] - Staining of human urinary bladder shows moderate membranous and cytoplasmic positivity in urothelial cells, as well as in endothelial cells.

Immunohistochemistry-Paraffin: EHD4 Antibody [NBP2-33665] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: EHD4 Antibody [NBP2-33665] - Staining of human duodenum shows strong positivity in endothelial cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

EHD4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit EHD4 Antibody - BSA Free (NBP2-33665) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: FGKENKKRELISRLPEIYIQLQREYQISAGDFPEVKAMQEQLENYDFTKFH
• Predicted Species: Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EHD4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  EHD4 Protein (NBP2-33665PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for EHD4 Antibody - BSA Free

• EH domain containing 4
• EH domain-containing protein 4
• EH-domain containing 4
• HCA10
• HCA11
• Hepatocellular carcinoma-associated protein 10/11
• hepatocellular carcinoma-associated protein HCA11
• ortholog of rat pincher
• PAST homolog 4
• PAST4

Background

EHD4 is an EH domain containing protein expressed in the extracellular matrix. EHD4 is the first extracellular matrix protein described that contains an EH domain.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EHD4
• Uniprot:
  • Q9H223(Human)