EHD3 Antibody - BSA Free

Western Blot: EHD3 Antibody [NBP2-31894] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunohistochemistry-Paraffin: EHD3 Antibody [NBP2-31894] - Staining of human kidney shows strong positivity in glomeruli.

Immunohistochemistry-Paraffin: EHD3 Antibody [NBP2-31894] - Staining of human placenta shows moderate membranous and cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: EHD3 Antibody [NBP2-31894] - Staining of human heart muscle shows moderate cytoplasmic positivity in cardiomyoctes.

Immunohistochemistry-Paraffin: EHD3 Antibody [NBP2-31894] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

EHD3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KLYKSKLLPLEEHYRFHEFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRY
• Predicted Species: Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EHD3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  EHD3 Protein (NBP2-31894PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for EHD3 Antibody - BSA Free

• EH domain containing 3
• EH domain-containing protein 3
• EHD2
• EH-domain containing 3
• PAST homolog 3
• PAST3

Background

The deduced protein identities between EHD1 and EHD2, between EHD1 and EHD3, and between EHD1 and EHD4, are 71%, 86%, and 76%, respectively. All contain multiple conserved regions that include a nucleotide binding consensus site at the N terminus, a bipartite nuclear localization signal, and an eps15 homology (EH) protein binding domain with an EF hand motif at the C terminus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for EHD3 Antibody (NBP2-31894)(1)

Publication using NBP2-31894

• Finch N, Fawaz S, Neal C et al. Reduced Glomerular Filtration in Diabetes is Attributable to Loss of Density and Increased Resistance of Glomerular Endothelial Cell Fenestrations Journal of the American Society of Nephrology : JASN 2022-03-15 [PMID: 35292439]

Bioinformatics

• Gene Symbol: EHD3
• Uniprot:
  • Q9NZN3(Human)