EGLN2/PHD1 Recombinant Protein Antigen

Images

 
There are currently no images for EGLN1/PHD2 Recombinant Protein Antigen (NBP2-76551PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

EGLN2/PHD1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EGLN2/PHD1.

Source: E. coli

Amino Acid Sequence: PLSQALPQLPGSSSEPLEPEPGRARMGVESYLPCPLLPSYHCPGVPSEASAGSGTPRATATSTTASPLRDGFGGQDGGE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
EGLN2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-76551.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for EGLN2/PHD1 Recombinant Protein Antigen

  • DKFZp434E026
  • EC 1.14.11
  • EC 1.14.11.-
  • egl nine homolog 2 (C. elegans)
  • egl nine homolog 2
  • EGLN2
  • EIT6
  • Estrogen-induced tag 6
  • FLJ95603
  • HIFPH1 EGL nine (C.elegans) homolog 2
  • HIFPH1
  • HIF-PH1
  • HIF-prolyl hydroxylase 1
  • HPH-1
  • HPH-3
  • Hypoxia-inducible factor prolyl hydroxylase 1
  • PHD1
  • Prolyl hydroxylase domain-containing protein 1

Background

HIF prolyl hydroxylase 1 (HPH-3 or EGLN2) is a prolyl hydroxylase that modifies HIF-alpha. Classic prolyl hydroxylases are found in the endoplasmic reticulum and modify collagen, whereas HIF is an intracellular protein and the HPH sites do not resemble those modifying collagen. HIF is a transcriptional complex that plays a critical role in oxygen homeostasis. HPH is an essential component of the pathway through which cells sense oxygen. In the presence of oxygen, HPHs convert specific prolyl residues in HIF-alpha to hydroxyproline, leading to HIF-alpha destruction. Low oxygen levels, sensed at the cellular level, cause the HIF conversion to be reduced so that HIF is stable and there is increased angiogenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-137
Species: Hu, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, KD, KO, Simple Western, WB
NB100-139
Species: Hu, Mu, Rt
Applications: ChIP, EM, ICC/IF, IHC,  IHC-P, IP, KD, MS, WB
NB100-105
Species: Bv, Ca, Fe, Ma, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh, Xp
Applications: ChIP, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, In vitro, KD, KO, LA, PLA, Simple Western, TCS, WB
NBP2-45411
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB100-124
Species: Bv, Ma, Hu, Mu, Pm, Rt, Sh
Applications: ChIP, CHIP-SEQ, GS, IB, ICC/IF, IHC,  IHC-P, IP, WB
NBP3-03807
Species: Hu, Mu, Rt
Applications: ICC/IF, IP, WB
NBP1-84949
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB100-122
Species: Fi, Ha, Hu, Mu, Pm, Rb, Rt, Re, Sh
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, In vitro, KD, KO, PAGE, Simple Western, WB
NB100-428
Species: Hu, Mu, Rt
Applications: EM, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, WB
DVE00
Species: Hu
Applications: ELISA
NB300-500
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr,  IHC-P, WB
MEP00B
Species: Mu
Applications: ELISA
NB120-19347
Species: Bv, Hu, Mu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-37371
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, WB
NB300-605
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, WB
NBP2-48615
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-858
Species: Gp, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr,  IHC-P, PEP-ELISA, WB
NBP2-76551PEP
Species: Hu
Applications: AC

Publications for EGLN1/PHD2 Recombinant Protein Antigen (NBP2-76551PEP) (0)

There are no publications for EGLN1/PHD2 Recombinant Protein Antigen (NBP2-76551PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EGLN1/PHD2 Recombinant Protein Antigen (NBP2-76551PEP) (0)

There are no reviews for EGLN1/PHD2 Recombinant Protein Antigen (NBP2-76551PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for EGLN1/PHD2 Recombinant Protein Antigen (NBP2-76551PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EGLN2/PHD1 Products

Research Areas for EGLN1/PHD2 Recombinant Protein Antigen (NBP2-76551PEP)

Find related products by research area.

Blogs on EGLN2/PHD1

There are no specific blogs for EGLN2/PHD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our EGLN2/PHD1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol EGLN2