EGLN2/PHD1 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EGLN2/PHD1. Source: E. coli
Amino Acid Sequence: PLSQALPQLPGSSSEPLEPEPGRARMGVESYLPCPLLPSYHCPGVPSEASAGSGTPRATATSTTASPLRDGFGGQDGGE Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
EGLN2 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10-100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-76551. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for EGLN2/PHD1 Recombinant Protein Antigen
Background
HIF prolyl hydroxylase 1 (HPH-3 or EGLN2) is a prolyl hydroxylase that modifies HIF-alpha. Classic prolyl hydroxylases are found in the endoplasmic reticulum and modify collagen, whereas HIF is an intracellular protein and the HPH sites do not resemble those modifying collagen. HIF is a transcriptional complex that plays a critical role in oxygen homeostasis. HPH is an essential component of the pathway through which cells sense oxygen. In the presence of oxygen, HPHs convert specific prolyl residues in HIF-alpha to hydroxyproline, leading to HIF-alpha destruction. Low oxygen levels, sensed at the cellular level, cause the HIF conversion to be reduced so that HIF is stable and there is increased angiogenesis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KD, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ChIP, EM, ICC/IF, IHC, IHC-P, IP, KD, MS, WB
Species: Bv, Ca, Fe, Ma, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh, Xp
Applications: ChIP, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, KO, LA, PLA, Simple Western, TCS, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Bv, Ma, Hu, Mu, Pm, Rt, Sh
Applications: ChIP, CHIP-SEQ, GS, IB, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Fi, Ha, Hu, Mu, Pm, Rb, Rt, Re, Sh
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, KO, PAGE, Simple Western, WB
Species: Hu, Mu, Rt
Applications: EM, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
Species: Hu
Applications: ELISA
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Bv, Hu, Mu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, WB
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Bt, Ca, Eq, Hu, Pm, Mu, Pm, Rb, Rt
Applications: ICC, IHC, IHC-P, IP, WB
Species: Hu
Applications: AC
Publications for EGLN1/PHD2 Recombinant Protein Antigen (NBP2-76551PEP) (0)
There are no publications for EGLN1/PHD2 Recombinant Protein Antigen (NBP2-76551PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for EGLN1/PHD2 Recombinant Protein Antigen (NBP2-76551PEP) (0)
There are no reviews for EGLN1/PHD2 Recombinant Protein Antigen (NBP2-76551PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for EGLN1/PHD2 Recombinant Protein Antigen (NBP2-76551PEP) (0)
Additional EGLN2/PHD1 Products
Research Areas for EGLN1/PHD2 Recombinant Protein Antigen (NBP2-76551PEP)
Find related products by research area.
|
Blogs on EGLN2/PHD1