EEN Antibody - BSA Free

Western Blot: EEN Antibody [NBP3-38429] - Western blot analysis of lysates from COS-7 cells, using EEN Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 60s.

• Reactivity: Hu, Mu, Rt, Pm
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

EEN Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit EEN Antibody - BSA Free (NBP3-38429) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 219-368 of human EEN (NP_003016.1).
  
  Sequence:
  VDAQLDYHRQAVQILDELAEKLKRRMREASSRPKREYKPKPREPFDLGEPEQSNGGFPCTTAPKIAASSSFRSSDKPIRTPSRSMPPLDQPSCKALYDFEPENDGELGFHEGDVITLTNQIDENWYEGMLDGQSGFFPLSYVEVLVPLPQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SH3GL1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 41 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for EEN Antibody - BSA Free

• CNSA1endophilin-2
• EEN fusion partner of MLL
• EENSH3 domain-containing GRB2-like protein 1
• Endophilin-2
• extra 11-19 leukemia fusion
• Extra eleven-nineteen leukemia fusion gene protein
• MGC111371
• SH3 domain protein 2B
• SH3-containing Grb-2-like 1 protein
• SH3D2Bendophilin-A2
• SH3-domain GRB2-like 1
• SH3P8

Background

Endophilin A2 is an SH3 domain containing protein implicated in endocytosis. It has been identified in human acute leukemia as a fusion partner of MLL (mixed-lineage leukemia). Because of its involvement in this chromosomal translocation, endophilin A2 is also known as EEN (extra eleven nineteen).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SH3GL1