EEF1A2 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit EEF1A2 Antibody - BSA Free (NBP2-33983) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: PGMVVTFAPVNITTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRR |
| Predicted Species |
Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
EEF1A2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for EEF1A2 Antibody - BSA Free
Background
EEF1A2 encodes an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 2) is expressed in brain, heart and skeletal muscle, and the other isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas. This gene may be critical in the development of ovarian cancer. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Fe, Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, KD, PLA, S-ELISA, WB
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Bv, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Po, V-Vi
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, In vivo, RIA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB, IHC
Publications for EEF1A2 Antibody (NBP2-33983) (0)
There are no publications for EEF1A2 Antibody (NBP2-33983).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for EEF1A2 Antibody (NBP2-33983) (0)
There are no reviews for EEF1A2 Antibody (NBP2-33983).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for EEF1A2 Antibody (NBP2-33983) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional EEF1A2 Products
Research Areas for EEF1A2 Antibody (NBP2-33983)
Find related products by research area.
|
Blogs on EEF1A2