EDNRB/Endothelin R Type B Antibody Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: CGLSRIWGEERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFK |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
EDNRB |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for EDNRB/Endothelin R Type B Antibody
Background
The Endothelin Receptor ETB is expressed in most tissues. Mutations of the receptor gene are responsible for Hirschsprung disease type 2, a multigenic disorder with phenotypes such as bicolored irides, megacolon, hypopigmentation, and hearing loss. The ETB receptor has similar affinity for all three endothelins and activates a phosphatidylinositol-calcium second messenger system. A splice variant, termed SVR, has been described; the sequence of the ETB-SVR receptor is identical to ET-B receptor, with the exception of the intracellular C-terminal domain. While both splice variants bind endothelin ET1, they exhibit different responses, which suggests that they may be functionally distinct. The endothelin B receptor has been reported to be expressed in adrenal, aorta, artery, brain, breast, eye, epididymis, ganglion, heart, kidney, liver, lung, ovary, placenta, prostate, skin, testis, uterus, and vessel. ESTs have been isolated from amnion, B-cell/lung/testis, breast, brain, colon, ear, embryo, eye, heart, kidney, liver, liver/spleen, lung, lymph node, placenta, prostate, and skin libraries.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, IHC, IP, ICFlow, WB
Species: Hu
Applications: Bind, BA
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: ICC, IHC, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC
Publications for EDNRB/Endothelin R Type B Antibody (NBP2-38136) (0)
There are no publications for EDNRB/Endothelin R Type B Antibody (NBP2-38136).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for EDNRB/Endothelin R Type B Antibody (NBP2-38136) (0)
There are no reviews for EDNRB/Endothelin R Type B Antibody (NBP2-38136).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for EDNRB/Endothelin R Type B Antibody (NBP2-38136) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional EDNRB/Endothelin R Type B Products
Research Areas for EDNRB/Endothelin R Type B Antibody (NBP2-38136)
Find related products by research area.
|
Blogs on EDNRB/Endothelin R Type B